KEGG   Acinetobacter baumannii BJAB07104: BJAB07104_02335Help
Entry
BJAB07104_02335   CDS       T02726                                 

Definition
Catalase
Orthology
K03781  
catalase [EC:1.11.1.6]
Organism
abj  Acinetobacter baumannii BJAB07104
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:abj00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BJAB07104_02335
  Amino acid metabolism
   00380 Tryptophan metabolism
    BJAB07104_02335
Enzymes [BR:abj01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     BJAB07104_02335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2406733..2408871)
Genome map
AA seq 712 aa AA seqDB search
MNDNTKSTNKTSEMAGADAANKANTTQKTEQLDTVRDDATNEALTTNQGVKIADNQNSLR
AGIRGSTLLEDFILREKITHFDHERIPERIVHARGVGAHGYFQAYEGNERLTKAGFLTDP
TIQTPIFVRFSTVQGPRGSADTVRDIRGFAIKFYTQEGNFDLVGNNAPVFFVQDGIKFPD
FVHAVKPEPDTEIPTGATAHDTFWDFVSLVPESAHAVIWAMSDRAIPRNLRSIQGFGVHT
FRLINAEGKSHFVKFHWTPKQGLSALVWDEAQKLAGKDPDFHRRDLYEAIEHGFYPEWEL
GVQIVEEEDEMNFDFDLLDPTKIIPEELVPVTPIGRFVLNRNVDNFFAETEQVAFCPGHV
VPGIDFTDDPLLQARLFSYTDTQLSRLGGPNFHQIPINKPVCPFHNNQRDGIHQHTIHKG
QAAYQPNSIDGNWPVETPPAASNGGFESYPEKISGHKLRQRSETFSDYFSQPRLYYKSLA
PHEQKHVVDAYTFELSKVQRKHIRERQVQQILANIDLDLARQVGANLGIEVPDLTLSYKK
TAVEKSAKLSFLAFPPEDIQGRKVAVLIHNMVKSDALEAIKNWAIKEGVILHLLAPSLAP
VKDHKDNVIVADGMQMSEPSIAYDAVIIPDGDNLNTVMQDGVARHYLLEAYKHLKPIVFL
GNKSDLLEPLGLVADEGTLIEDEFQHVAEKFKNLIKAHRVWSREQIAAHVPA
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacaatactaaatcaaccaataaaacaagtgaaatggctggtgccgatgcagca
aataaagccaatactacccagaaaactgaacagttagacacagttagagatgatgcaact
aatgaagctttaaccacaaatcagggggttaaaatagcggataaccaaaatagcttaaga
gcgggtattcgtggctcgactttattggaagatttcattttaagagaaaaaatcacccac
tttgaccatgagcgtatacctgagcgtattgtgcatgcgcgtggtgtaggggcacatggt
tattttcaggcatatgaaggaaacgaacgtttaaccaaagctggattcttgacagaccca
actattcagacgcctatttttgtacgtttttcaacagtccaagggcctcgtggttcagcc
gatactgtccgtgatattcgcggttttgccattaagttttatacccaagaaggtaacttc
gacttggtaggaaataacgcacctgtcttttttgtgcaagacgggattaaatttccagac
tttgtacatgcggtaaaacctgaaccggacacagaaattccaacgggtgcaactgcgcat
gatactttctgggattttgtgtctttagtgcccgagtcagcacatgctgtaatttgggca
atgtcagaccgtgcgattcctcgtaacttacgttcgatccaagggtttggtgttcatacg
ttccgtttaattaatgctgaaggtaaatcacattttgtgaaatttcactggacaccaaaa
caaggtttaagtgcgctggtatgggatgaagctcaaaaacttgcaggtaaagacccggat
ttccaccgtcgtgatctttatgaagcaattgagcacggtttttatccagaatgggaactc
ggcgtgcagattgtcgaagaagaagatgaaatgaactttgacttcgatttgctggaccca
acaaaaattattcctgaagaattagttcctgttacgccaattggccgatttgttttaaat
agaaatgtagataacttctttgctgaaacagagcaggtagctttctgtccgggtcatgta
gtacctggtattgattttactgatgacccacttttacaagcccgtctattttcatacaca
gatacccagttaagccgtttaggtggaccaaactttcaccaaattccgattaacaaacct
gtgtgtccattccataacaatcaacgtgatggtattcatcagcataccattcataaagga
caggctgcatatcaaccaaactcaattgatggaaattggccagtagagacaccgccagcg
gcatcaaatggtggttttgaaagttatcctgaaaaaattagtgggcataaacttcgtcaa
agaagtgagacgttctctgattatttctctcaaccacgactttattacaaaagccttgca
ccgcatgaacaaaaacatgtggtcgatgcctatacttttgaattaagtaaagttcaaaga
aagcatattcgtgagcgtcaagttcaacaaattttggctaatatcgacttagatttggca
cgccaagtaggggcaaatttaggtattgaagtgcctgacttaaccctaagttataagaaa
acagcagttgaaaaatctgccaagttatcttttttagctttcccacctgaagatattcaa
ggtagaaaagttgccgtacttatccataacatggtgaagtctgacgcattagaagctatt
aaaaactgggcaattaaagaaggcgtaatccttcacttactagcgccgagcttggctcca
gtcaaagatcataaagataacgttattgtggctgatggcatgcaaatgtctgagccttca
attgcctatgatgcggtaattattccggatggcgataacctaaatacggttatgcaagac
ggggtagctcgccattacttactcgaagcttataagcacttaaagccaatcgtatttttg
ggtaataaatctgatttgcttgaaccattaggtttagtggcagatgaaggaactttaatt
gaagatgagttccagcatgttgcggaaaaatttaagaacctgattaaagcacaccgtgtt
tggtcacgagaacaaatagccgcacatgtaccggcttaa

DBGET integrated database retrieval system