KEGG   Acinetobacter baumannii BJAB07104: BJAB07104_02369Help
Entry
BJAB07104_02369   CDS       T02726                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
abj  Acinetobacter baumannii BJAB07104
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:abj00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BJAB07104_02369
   00630 Glyoxylate and dicarboxylate metabolism
    BJAB07104_02369
   00640 Propanoate metabolism
    BJAB07104_02369
   00650 Butanoate metabolism
    BJAB07104_02369
  Lipid metabolism
   00071 Fatty acid degradation
    BJAB07104_02369
   00072 Synthesis and degradation of ketone bodies
    BJAB07104_02369
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BJAB07104_02369
   00310 Lysine degradation
    BJAB07104_02369
   00380 Tryptophan metabolism
    BJAB07104_02369
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BJAB07104_02369
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BJAB07104_02369
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BJAB07104_02369
Enzymes [BR:abj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BJAB07104_02369
Exosome [BR:abj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BJAB07104_02369
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2446677..2447882
Genome map
AA seq 401 aa AA seqDB search
MLNAYIYDGLRSPFGRHAGELASIRPDDLAATVIQKLLEKTGVPGADIEDVILGDTNQAG
EDSRNVARNALLLAGLPVTVPGQTVNRLCASGLGAVIDSARAITCGEGELYIAGGVESMS
RAPFVMGKAESAYSRDAKIYDTTIGSRFPNKKIIAQYGGHSMPETGDNVAAEFGISREQA
DLFAAQSQAKYQKAKEEGFFADEITPIEVFQGKKLPPKFVSEDEHPRPSSTVEALTKLKP
LFEGGVVTAGNASGINDGAAALLIGSEAAGQKYGLKPMAKILSAAAAGIEPRIMGAGPIE
AIKKAVARAGLTLDDMDIIEINEAFASQVLSCLKGLNVDFNDPRVNPNGGAIAVGHPLGA
SGARLALTVARELIRRKKKYAVVSLCIGVGQGLAMVIENVS
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgttaaatgcatatatttatgatggtttacgtagtccatttggccgtcatgcaggtgaa
cttgcctcaattcgtcctgatgatttggccgcaactgtcattcaaaaactactagaaaaa
actggtgtaccgggcgctgatattgaagatgtgattttaggcgacactaaccaagcgggt
gaagatagccgtaatgtggcacgaaatgcattattacttgcaggtttacctgttactgta
ccgggccagacggtaaaccgcctatgtgctagtggtttaggtgccgtgattgactcagca
cgtgctattacttgtggtgaaggtgaactgtatattgctggtggtgtagaaagtatgtca
cgtgcaccctttgtgatgggtaaagcagaaagcgcttatagccgtgatgcaaaaatttat
gacaccaccattggctctcgctttccaaataaaaaaattattgctcagtacggcggacat
tcaatgcctgaaacgggcgataacgttgcagccgagtttgggattagtcgtgagcaagca
gacttatttgcagcccaatcacaagccaaatatcaaaaagccaaagaagaaggtttcttt
gccgatgaaattactccaattgaggttttccaaggcaaaaaattgccccctaaattcgtt
tcagaagatgaacatcctcgcccaagttcaactgttgaagcactcacaaagttaaaaccg
ctatttgaaggtggcgtggttacagctggtaatgcctcaggtattaatgatggtgcagca
gcacttttgattggttcagaagcagcaggtcaaaaatatggcttaaaaccaatggcaaaa
atcttatcagcggcggctgcaggtattgagccacgcattatgggtgcaggtccgatcgaa
gccattaaaaaagcggttgcacgtgctggccttactttagatgacatggatattattgaa
attaatgaagcctttgcttcacaagttttatcttgtttaaaaggtttaaatgttgatttt
aatgatccacgtgtgaacccgaacggtggtgcgattgctgttggtcatccacttggtgct
tcaggcgctcgtcttgcgttaacagtagcgcgcgagttaattcgccgtaagaagaaatat
gccgtggtgagcttatgtattggtgtaggtcaaggtcttgcgatggtgattgaaaacgtt
tcataa

DBGET integrated database retrieval system