KEGG   Acinetobacter baumannii BJAB07104: BJAB07104_02639Help
Entry
BJAB07104_02639   CDS       T02726                                 

Definition
Membrane carboxypeptidase (penicillin-binding protein)
Orthology
K05365  
penicillin-binding protein 1B [EC:2.4.1.129 3.4.-.-]
Organism
abj  Acinetobacter baumannii BJAB07104
Pathway
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:abj00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BJAB07104_02639
Enzymes [BR:abj01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     BJAB07104_02639
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-  Acting on peptide bonds (peptidases)
    3.4.-.-  
     BJAB07104_02639
Glycosyltransferases [BR:abj01003]
 Polysaccharide
  Bacterial polysaccharide
   BJAB07104_02639
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2735446..2737842
Genome map
AA seq 798 aa AA seqDB search
MKFERGIGFFALIFSILVIGAFIALSIYLIRLDNIIREKFEGQRWDIPAKVFARPLEIYN
NAPITQANFTQELKLLGYKTSSNYDKSGTYVAQGSNMYVHTRGFDYGDSVESEQVLELSF
ANDQVVEVRSTKPSSTGVARLEPLLIGGIYPQHNEDRVLIKLNSVPKPLIEALISTEDRN
FYHHHGISIRGTARALVSNVTGGRRQGGSTLTQQLVKNFYLTPERTLKRKVNEALMALLI
ELHYSKDEILEAYLNEVNLGQNGNYSINGYGLASQFYFGLPLRELNVAQQAYLVGLVQGP
SLYNPWKNPEGAKNRRDTVLNNMRVMGYLTQAEYETEIARPLNVLSKPSLGPAKFPDFLD
IVRRQLRTEYQESDLTNQGLRIFTTLDPIAQTQVQNAFKASVERLANSNPARLKNLQGAV
LIAHPENGELIAAVGSTQDFTGFNRALDAKRQVGSLLKPVIYLSAIESGRYNWASQIEDA
PISVPVDGGKSWTPKNYSGGGHGIVSLSEALANSYNLSAVRLGQEFGLSTFTNNLRKFGV
ESTIPAYPSIFLGAVNMSPMEVLGIYENFATGGFKYPTRAIRSVVDANGRLLDRYGLNVQ
QTIDPSVGYIMNYGLQQVMSSGTGRAAYNSLSPALKLAGKSGTTNDTRDSWFAGYSGNHV
AVVWLGLDDNKVTGLTGSSGALPVWINVMKQLRQTPVNLRQPDSVQWQWIDRASGDLSAQ
ACDGAMYIPMLAHTVPHRATPCGAPYYQVDPTYTPQSDNTIPEPQDDNTDSYIRESENQM
EQDLSNNTRIISSGSYNN
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttgaacgtggtatcggtttcttcgcgctaattttttccattttggtgattggt
gcttttattgctcttagtatctatctgattcgtttagataatattatacgtgaaaaattt
gaaggacaacgctgggacattccggccaaggtgtttgctcgacctttggaaatttataat
aatgcgccaattactcaagcaaatttcacccaagaattaaaattactaggttacaaaact
tcaagtaattatgacaagtctggaacctatgttgctcaaggcagcaacatgtatgtccat
acacgtggtttcgactatggcgacagcgtagagtctgaacaggttttagaactgagtttt
gcaaacgaccaagttgtagaagttcgcagtacaaaaccttcctcaactggagttgcccgt
ttagaacctttattaattgggggcatttatcctcaacataatgaagaccgcgttttgatt
aagcttaatagtgttcctaaaccacttattgaagctttaatttctacagaagaccgtaac
ttttatcatcaccacggtatttcgattcgtggtacagcacgtgctttggtaagtaatgta
actggaggacgtcgccaaggtggttcgaccctcacccaacagttagtcaaaaacttctat
ctaacccctgaacgcacacttaaacgtaaagttaatgaagcattaatggctttacttatt
gagttgcattacagcaaagatgaaattttagaagcatatttaaatgaagtgaatttaggt
caaaacggtaactattcaatcaatggttatggattggcctctcagttttatttcggttta
ccactacgtgagcttaatgttgcacaacaagcttatttagtcggtttggttcaaggtcca
tctttatataatccttggaaaaaccccgaaggggcaaaaaatcgtcgcgatacagtatta
aataacatgcgtgtcatggggtatttaactcaagcagagtatgaaactgaaattgcgcgt
cctttaaatgttctaagcaaaccaagcctaggtccagcaaaattccctgactttttagat
attgtgcgtcgtcaattacgtaccgaatatcaggaaagtgatttaaccaatcaaggatta
cgtatttttacgaccttggacccaattgctcaaacacaagttcaaaatgcctttaaagct
tctgtagagcgcttagctaatagcaaccctgctcgcttgaaaaacctgcaaggggctgta
ctgattgcccatcctgaaaatggcgaattaattgcagctgtcgggtcaacgcaagacttt
accggctttaaccgtgccttagatgcaaaacgccaagtcggttctttattgaaacctgtc
atttatttgagcgcaattgaatctggacgttataactgggcaagccagattgaagacgct
ccaattagtgttccagtagacggcggtaaaagttggacaccgaagaactatagcggcggt
ggtcatggaattgtgagtttaagtgaagccttagcaaattcttataacctttctgctgtg
cgcttaggtcaagagttcgggttatctacatttaccaacaatttaagaaaatttggtgtt
gaatcgacaatcccggcctacccttctattttccttggtgcagtcaatatgtcaccaatg
gaagtactgggtatttatgaaaactttgctacaggcggtttcaaatatccgactcgtgcg
attcgttctgttgtagatgcaaatggacgtttacttgatcgttatggtctaaacgtacaa
caaaccattgatccatctgtcggttatatcatgaactatggtttacaacaggtcatgtca
tcaggtacaggacgtgcagcctataacagcttatctccagctttaaaattagcgggtaaa
tcaggtacgactaacgatacacgtgactcatggtttgccggctattcaggtaatcatgtt
gcagtagtatggttaggtttagatgacaataaagtaactggtttaacaggttcatctggt
gcattaccagtatggattaatgtgatgaaacaattacgccagacaccagtaaacttacgt
caaccagactctgtacagtggcaatggattgaccgtgcatcgggtgacttatcagcacaa
gcttgtgatggtgccatgtatattccaatgctagcgcatacagtcccacatcgtgctacg
ccatgtggagcaccgtattatcaagttgatccaacatatacgccacaaagtgataacaca
attcctgagcctcaggatgataataccgacagttatattcgtgaaagtgaaaaccagatg
gaacaagatctgtcgaataacacacgaatcatttcaagtggtagttataacaactaa

DBGET integrated database retrieval system