KEGG   Acinetobacter baumannii BJAB07104: BJAB07104_02864Help
Entry
BJAB07104_02864   CDS       T02726                                 

Definition
Glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
abj  Acinetobacter baumannii BJAB07104
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:abj01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:abj00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2997434..2998567)
Genome map
AA seq 377 aa AA seqDB search
MIEVVDGQRKLSECKRIVVKIGSSLLTANGQGLDLDAISHWAKQIADLHNAGHEIILVSS
GAVAEGMVRMKLASRPTDLPSLQACAAIGQMGLIHTWSSVLENHSIRTAQVLLTHDDLAD
RRRYLNSCDALQNLIDWRVIPVINENDTVSTDEIRFGDNDTLAAMVAGQVHADLLIILTD
QQGMFDSDPRHNPDAKLLSTVRAMDDVLFEMAGGGGVLGRGGMVTKVRAARLAAKSGCPT
LIASGESDNVLSRVMAGEMLGTLFTTDKDRMTAHQQWLAAHLQTAGRLVIDDGAVEAIKL
KHRSLLPVGVKTVEGHFDRGDVVECVDKQGKRVAVGRVNFSSRSAEIIKGLSSDKVYQVL
GEARSLEMIHRDHMAIY
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgatagaagtggtcgatgggcaacgtaagctcagtgagtgtaaacgaatcgttgttaaa
atcggatcatctttactcacggcaaatgggcagggtctagatctggacgctatttcgcat
tgggcgaaacagattgcagatttacacaatgctggacacgaaattattttagtgtcttca
ggagctgtggcagaaggtatggttcgtatgaagcttgcgagtcgacccaccgatctaccc
agtcttcaagcatgcgccgcaattgggcagatgggcctaattcatacttggtctagtgtg
cttgaaaatcatagtatccgaactgctcaggtgttgttaacacatgatgatttggcagac
cgccgtcgttacttaaattcatgtgatgcattgcagaacttgattgattggcgtgttatt
ccggtcattaatgaaaacgatactgtatctaccgatgagattcgttttggtgataacgat
acactagcagctatggttgctggtcaagtacatgctgatttattaattattttaacagat
cagcaaggtatgtttgattcagacccacgtcataatcctgatgcaaagttattatcaact
gtgcgtgccatggatgatgttttatttgaaatggctggtggtggcggtgtgcttggacga
ggtggcatggtcactaaagttcgtgctgcacgtttagctgccaagtcaggttgcccgaca
ttgattgctagtggtgaaagcgacaatgtgttgtcacgagtgatggctggtgagatgctg
ggtacattgtttacgactgataaagaccgtatgacagcgcatcagcaatggcttgctgca
catttacaaacagcgggtcgtcttgtaattgatgatggcgcagttgaagcgattaaattg
aaacatcgcagtttattgcctgttggggtaaaaactgttgaaggacattttgatcgtggt
gatgtggttgaatgtgtcgataaacaaggtaaacgtgttgcggttgggcgagtgaatttt
agctctcgttctgctgaaattattaaaggtctttcttcagacaaagtttatcaagtactt
ggtgaagcccgttcattagaaatgattcatcgcgatcatatggcaatttactaa

DBGET integrated database retrieval system