KEGG   Acinetobacter baumannii BJAB07104: BJAB07104_03157Help
Entry
BJAB07104_03157   CDS       T02726                                 

Definition
Protein-disulfide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
abj  Acinetobacter baumannii BJAB07104
Brite
Enzymes [BR:abj01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     BJAB07104_03157
Secretion system [BR:abj02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   BJAB07104_03157
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3329457..3330167
Genome map
AA seq 236 aa AA seqDB search
MKTKLATLMLSLAFFGSAHADVKTLEQNLKTNYPDLPVKGVYQSPVAGIYEVYTSGRIVY
TNQDAKYFFVGNLVDIKQQKNMTEERIAELGKIDVKSLPLNQAIKYVKGKGERTLYIFSD
PDCPYCQRLEQNMVGVDNVTVYVFLYPLTSLHPNAEKVSNQIWCSKNPSEAWTNYMLNRK
LPAAGKSCTSPIQKNIALGQKLNIDGTPTLFLQDGQRISGVPSDAKQIEALLQSVK
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactaaacttgctacactcatgttgagtttggcttttttcggttctgctcatgct
gatgttaaaacacttgaacaaaatctgaagacaaattatccagacctccctgtaaaaggt
gtctatcagtcacctgtcgctggaatttatgaagtctatacaagtggccgtattgtttat
accaatcaagatgcaaaatacttttttgtaggcaatttagttgatatcaaacaacaaaaa
aatatgacagaagagcgaattgccgaattgggtaaaattgatgttaaaagtctcccatta
aatcaggcaattaaatacgtcaaaggtaaaggagagcgtactctttatattttcagtgac
cctgattgcccttactgtcagcgtctagaacaaaatatggttggggtggataacgtaacc
gtatatgtattcttatatccgctgaccagcttacatccaaatgctgaaaaggtttctaat
caaatctggtgctctaaaaacccttcagaagcatggacaaattatatgcttaaccgtaaa
ttgccagcggctggcaaaagctgtacaagtccaattcagaaaaatattgctttaggccag
aaattaaatatagatggtacacccactctgttcttacaagatggtcaaagaatctctggc
gtaccaagtgatgcaaaacagattgaagcattattacagtcagtaaaataa

DBGET integrated database retrieval system