KEGG   Arcobacter butzleri 7h1h: A7H1H_1054Help
Entry
A7H1H_1054        CDS       T02755                                 

Definition
thiol:disulfide interchange protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
abl  Arcobacter butzleri 7h1h
Brite
Enzymes [BR:abl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     A7H1H_1054
Secretion system [BR:abl02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   A7H1H_1054
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(994821..995561)
Genome map
AA seq 246 aa AA seqDB search
MFNLTKKLVMILLFIGTFLFAENKELPKNEISKIEQLEIFKKANIKILKAYDAGSLYILT
ISVHGNKDEIYLTKDKKFIISGTVVNVSNEMQVSAPVDLSITKDKEAFVYGNGKDEYVLF
TDPECPFCKKFESYLPEIKDKVKIRVFFYPLDFHENARDLSLYILSQKTTSQKIDALYEF
NIGDNLSKVKNAKYSKSELSKLEKQLNEHIKIATELNIQGTPALFDKNGNSIVWVNMLEK
YGIEVR
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgtttaatctaacaaaaaaattagttatgattttattatttattggaacatttttattt
gcggaaaataaagaactaccaaaaaatgaaatttctaaaatagaacaattagaaatattt
aaaaaagcaaatataaaaatcttaaaagcttacgatgctggaagtttgtatattttaact
atcagtgtacatggaaataaagatgaaatttatctaacaaaagataaaaaatttattatc
tcaggtacagttgtaaatgtatcaaatgagatgcaagtttcagctccagttgatttatca
attacaaaagataaagaagcttttgtttatggaaatggaaaagatgaatatgtattattt
acagatcctgaatgtccattttgtaaaaaatttgagtcatatttaccagaaatcaaagac
aaagttaaaattagagtatttttttatcctttagactttcatgaaaatgctcgtgattta
tctttatacattctaagtcaaaaaacaacttcacaaaaaattgatgctctatatgaattt
aatattggtgataacttgagtaaagtaaaaaatgcaaaatactcaaaatcagagctttca
aaacttgaaaaacagttaaatgaacatattaaaattgcaactgaattaaatattcaagga
actcctgccttatttgataaaaatggtaatagtatcgtttgggttaatatgctagaaaaa
tatggtattgaagtaagatag

DBGET integrated database retrieval system