KEGG   Arcobacter butzleri 7h1h: A7H1H_1317Help
Entry
A7H1H_1317        CDS       T02755                                 

Definition
conserved hypothetical protein, putative aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
abl  Arcobacter butzleri 7h1h
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:abl00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    A7H1H_1317
Enzymes [BR:abl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     A7H1H_1317
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1270781..1271359
Genome map
AA seq 192 aa AA seqDB search
MVDKDTIKLLSDLSFSMFSKNFFGIYHGAISSKLDQYNFMINTSDAIFDKMDEKSFCTLN
MNKQDYRWNIASIESHIHSTIYTNIHEAKYIAFGMPIYTTAYTLLHDKIVFEDFFGKTFF
GELSIYNPGDFSTWYKRNALEITKYLKESEHNLMVIKGVGTYVYDRDVYELVKKIAILEN
SCRLLSIKSSFE
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggtagataaagatactataaaattactctctgatttatcattttctatgtttagtaag
aacttttttggtatctatcatggtgcaatttcttctaaacttgatcaatataactttatg
ataaatacgagtgatgctatatttgacaaaatggatgaaaaatctttttgtactttaaat
atgaataaacaagattatagatggaatattgctagtatcgaatctcatattcattcgaca
atatatacaaatatccatgaagcaaaatatattgcttttggtatgccaatttatacaaca
gcctatacattacttcatgacaaaatagtatttgaagatttttttggtaaaacttttttt
ggagaattatctatttataatcctggtgatttttcaacttggtataaaagaaatgccctt
gaaattacaaaatatttaaaagaatctgaacataatttgatggttataaaaggtgtagga
acttatgtatatgatagagatgtttatgaactagttaaaaaaatagctattcttgagaat
tcttgtagacttttaagtataaaaagttcttttgaataa

DBGET integrated database retrieval system