KEGG   Acinetobacter baumannii SDF: ABSDF0079Help
Entry
ABSDF0079         CDS       T00660                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
abm  Acinetobacter baumannii SDF
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:abm00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ABSDF0079 (galU)
   00052 Galactose metabolism
    ABSDF0079 (galU)
   00500 Starch and sucrose metabolism
    ABSDF0079 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    ABSDF0079 (galU)
Enzymes [BR:abm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     ABSDF0079 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
81319..82194
Genome map
AA seq 291 aa AA seqDB search
MIKKAVLPVAGLGTRFLPASKSIPKEMVTVVDRPAIEYVVREAVEAGIEQIILVTHSSKA
SIENYFDRNLELETTLEQKKKFDLLAEITQIVPEHVSVVSVRQPQPLGLGHAVLCAKSVV
GQDDFAVLLPDVLVKDSSGQNDLSRMISRYNSSQAAQIMVEAVPDHLVDQYGIVDVKHSP
NEGESIAMQGIVEKPAVGSAPSNLSVVGRYVLPAKIMQLLENTPKGAGNEIQLTDAIAML
QDTDTVEAYRMQGQTFDCGSKIGYLKAVLHYGIEHPKLGNDFKKLIQELKL
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaagcagttttaccagtagctggtttaggtacacgttttctaccggcaagt
aagtctattccaaaggaaatggtaacggtcgttgatcgtcctgcaattgaatatgtagta
cgcgaggcggtagaggctggaattgaacaaattattttagttactcattcatcgaaagca
tcaattgaaaattattttgatcgtaaccttgagttggaaaccaccctagaacaaaagaaa
aaattcgatttacttgcagagattactcaaattgtgcctgagcatgtgagtgtagtaagt
gtaagacaacctcagcctttaggcttagggcatgctgtgttatgtgcaaagagtgttgtc
ggtcaagatgatttcgctgtgctattaccagatgtattggtgaaagatagctctggacaa
aatgatctatcccgtatgatttctcgctataactcaagccaagctgctcaaatcatggtt
gaagcagtgccagaccatttagtagatcaatatgggattgtggatgtaaaacatagccca
aatgaaggtgaaagcattgctatgcagggtattgttgaaaagcctgcagtaggctctgca
ccatcaaacttatcggtggttggccgctatgtgttacctgccaagattatgcaattactt
gagaacacgccgaaaggtgcgggtaatgaaattcagttaactgatgcaattgcaatgctt
caagacacagatactgttgaagcttatcgtatgcaaggtcaaacgtttgattgtggtagt
aagattgggtatttaaaagctgtactacactatggaattgaacaccctaagttaggaaat
gattttaaaaagttaattcaggaacttaaattataa

DBGET integrated database retrieval system