KEGG   Acinetobacter baumannii SDF: ABSDF0175Help
Entry
ABSDF0175         CDS       T00660                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
abm  Acinetobacter baumannii SDF
Pathway
abm00480  Glutathione metabolism
abm00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:abm00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    ABSDF0175
  Metabolism of other amino acids
   00480 Glutathione metabolism
    ABSDF0175
Enzymes [BR:abm01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     ABSDF0175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: CAO99578
UniProt: B0VNK8
Position
complement(163045..163590)
Genome map
AA seq 181 aa AA seqDB search
MTQSVYHIPVKTISGETVDLDQYKGKVLLIVNTASKCGLTPQYEGLEKLYQAKKDQGLEI
LGFPANNFKEQEPGSDEEIQQFCSLNYDVHFPLFSKISVAGEDKHPLYQALTTAQPERIG
EGPFRERLEGLGIPTNPAPEVLWNFEKFLVNKNGEVIARFAPNLTADDEQIVKAVEAELA
K
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgactcaatctgtatatcatattccagtaaaaactatttcaggcgaaacggttgacctt
gaccaatataaagggaaagttttattaatcgtaaacacagcgtctaaatgtggtttaact
ccacaatacgaaggtttagaaaagctgtatcaagcaaagaaagatcaaggtcttgaaatc
ttaggcttccctgcaaacaactttaaagaacaagagcctggttcggatgaagaaattcaa
cagttctgctcattaaactacgatgttcatttcccacttttctctaaaatctctgtagct
ggcgaagataaacatccactttatcaagcgctaacaacagctcaaccagaacgtattgga
gaaggccctttccgtgagcgcttagaaggtttaggtattcctactaaccctgcccctgaa
gtgttatggaacttcgagaaattcctagtaaataaaaacggtgaagttattgcgcgtttt
gcacctaacttaacagcagacgatgaacaaattgtaaaagcagttgaagcagaattagct
aaataa

DBGET integrated database retrieval system