KEGG   Acinetobacter baumannii SDF: ABSDF0322Help
Entry
ABSDF0322         CDS       T00660                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
abm  Acinetobacter baumannii SDF
Pathway
abm00230  Purine metabolism
abm01100  Metabolic pathways
Module
abm_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:abm00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    ABSDF0322 (gmk)
Enzymes [BR:abm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     ABSDF0322 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_16 AAA_33 MobB AAA_22 AAA RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: CAO99716
UniProt: B0VQ52
Position
complement(302827..303456)
Genome map
AA seq 209 aa AA seqDB search
MSGLLFVVSAASGTGKTSLVKALLDRVSNLHVSVSHTTRGQRPGELDGVHYHFTTKDEFL
DQVNQGGFIEYAEVFGNYYGTSQATVKQQLAQGHDVLLEIDWQGAEQVRKLFPESKQIFI
LPPTQFDLRQRLSNRGTDSVEVIEHRLSCAVEDMQHYVNFDYIIINDDFNKALHELEAVI
TANRLVLSQQAKRHQNLIQDLITPQPKQE
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggtctattgtttgtcgtttctgctgcatcaggaacgggcaaaacatctttggtg
aaagccctacttgaccgtgtgagcaatttacatgtttcagtttcgcatactacccgaggt
caacgaccaggtgagttagatggtgttcactatcacttcacaacaaaagatgaattttta
gaccaagtgaaccaaggtggatttatcgaatatgctgaagtatttggtaattactatggc
acttcgcaagcaaccgtaaaacaacagttagctcaaggacatgatgtcttgcttgaaatt
gactggcaaggtgcagagcaagtacgcaagctgtttcctgaatctaaacagatctttatt
ttaccacctactcaattcgatttacgtcaacgtttatctaaccgtggtacagactctgtt
gaagttattgaacaccgcttaagctgtgctgttgaagacatgcagcactatgtaaatttc
gactatatcatcattaatgatgactttaataaagccctacatgagcttgaagccgtcatt
accgcaaatcgtttagtcttatctcaacaggcaaaaagacatcaaaatctaattcaagac
ttgattactccacaaccaaaacaggaataa

DBGET integrated database retrieval system