KEGG   Acinetobacter baumannii SDF: ABSDF0573Help
Entry
ABSDF0573         CDS       T00660                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
abm  Acinetobacter baumannii SDF
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:abm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ABSDF0573 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ABSDF0573 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ABSDF0573 (trpA)
Enzymes [BR:abm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ABSDF0573 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
524834..525637
Genome map
AA seq 267 aa AA seqDB search
MSRLATRFEKLQSQQRKALVSYVMAGDPQPQVTVPLLHKMVAAGVDVIELGLPFSDPMAD
GPVIALAAERALAAGTNTLDALNMVKEFREQDQETPVVLMGYLNPVEVIGYEKFVSYAKQ
CGVDGLLLVDLPPEESKEFGAILKQHDMDQIFLLAPTSTDQRIQHVANQASGFIYYVSLK
GVTGAATLDTSEAAARIEKIKGMTNVPVGVGFGISDAASAKAMGSVADAVIVGSAFVKSF
ATLAADEAVEQTVNKVKELRAALDELV
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtcttgccacccgttttgaaaagctgcagtcccaacaacgtaaagcgcttgta
tcttatgtcatggcgggtgatccacagccacaagtaacggtgccgttacttcataaaatg
gttgcggcaggagtagacgtcattgagcttggtttaccattttcagacccgatggctgat
ggtccggtaattgcacttgctgctgaacgcgcacttgcggctgggacgaacaccttagat
gcgctgaacatggtaaaagagtttcgtgagcaggatcaggaaacacctgtagttttaatg
ggttatcttaatcctgttgaagtgattggttacgagaagtttgtttcttatgcgaaacaa
tgtggtgtagatggcttattacttgtggacttaccaccggaagagtcaaaagaatttggt
gcaatcttgaaacaacatgatatggaccagattttcttacttgcaccaacttcaactgat
caacgtattcaacacgtagcgaatcaggcaagcgggtttatctactatgtttcactcaaa
ggtgtaacaggtgcagcgactttggatacttctgaagcggctgcacgtattgaaaaaatc
aaaggtatgactaacgttccagttggcgttggtttcggaattagtgatgctgcttcagcg
aaagcgatgggtagtgttgcagatgccgtgattgtaggtagtgctttcgttaaatctttt
gcaacgttggcagctgatgaagctgttgaacagacggtgaataaagtcaaggagcttcga
gcagcgctcgatgagttagtatga

DBGET integrated database retrieval system