KEGG   Acinetobacter baumannii SDF: ABSDF0590Help
Entry
ABSDF0590         CDS       T00660                                 

Definition
(GenBank) putative 3-hydroxybutyryl-CoA epimerase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
abm  Acinetobacter baumannii SDF
Pathway
abm00071  Fatty acid degradation
abm00280  Valine, leucine and isoleucine degradation
abm00281  Geraniol degradation
abm00310  Lysine degradation
abm00362  Benzoate degradation
abm00380  Tryptophan metabolism
abm00410  beta-Alanine metabolism
abm00640  Propanoate metabolism
abm00650  Butanoate metabolism
abm00903  Limonene and pinene degradation
abm00930  Caprolactam degradation
abm01040  Biosynthesis of unsaturated fatty acids
abm01100  Metabolic pathways
abm01110  Biosynthesis of secondary metabolites
abm01120  Microbial metabolism in diverse environments
abm01130  Biosynthesis of antibiotics
abm01200  Carbon metabolism
abm01212  Fatty acid metabolism
Module
abm_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:abm00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ABSDF0590
   00650 Butanoate metabolism
    ABSDF0590
  Lipid metabolism
   00071 Fatty acid degradation
    ABSDF0590
   01040 Biosynthesis of unsaturated fatty acids
    ABSDF0590
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ABSDF0590
   00310 Lysine degradation
    ABSDF0590
   00380 Tryptophan metabolism
    ABSDF0590
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ABSDF0590
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ABSDF0590
   00281 Geraniol degradation
    ABSDF0590
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ABSDF0590
   00930 Caprolactam degradation
    ABSDF0590
Enzymes [BR:abm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     ABSDF0590
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ABSDF0590
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     ABSDF0590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 AlaDh_PNT_C Methyltransf_31 F420_oxidored DUF5333
Motif
Other DBs
NCBI-ProteinID: CAO99969
UniProt: B0VRH5
Position
complement(541077..543212)
Genome map
AA seq 711 aa AA seqDB search
MSAIQYEKNADNIVILTLDSTGQPANTMNAEFRDSLDEVTQKLKAETELSGVIFRSAKKT
FFAGGDLDELIQIQPEHATDFFNMVEKLKGHLRTIETLGIPVVAALNGTALGGGWEIALS
CHHRIAINDPKSKFGLPEVTLGLLPGGGGIVRMVRLLGLQNAFPFLMEGKQFGVDKAKSL
GLIHDTAENEQELLDKAIAWIKANPKSQQPFDVKGYKIPGGDPKTPAVAQVLAIAPAMLK
DKTKGCYPAPEAIMAAAVEGAQVDVDTALRIESRYFTQLATGQISKNMIGTFWHGLNAIK
SGASRPADIAKWQATKVGVLGAGMMGAGIAYATAIKGIPVILKDVSVENAEKGKAYSQKL
LDKRVSQGRMTAEKRDQILSLITATASAEDLQGCDLIIEAVFENQELKAKVTQEAEQYLA
PNGVIASNTSTLPITGLAQASKNDKAFIGLHFFSPVDKMQLVEIIKGKNTSAETLAKAYD
FVQQIGKTPIVVNDSRGFFTSRVFGTFIQEGMRLLAEGVHPARIEMAALKAGMPVGPLAI
QDEVSLTLTEHVASEARKALQAEGKELPKTPVDEVIHTMIHELNRKGKAAGAGFYDYPEN
GKKHLWEGLNRWQKDHDISEQDMIDRILFVQALDTLRCYEEGVLESVIDANVGSIFGIGY
APWTGGAIQFLNQYGIDKAQKRAEELAAKYGERFTPPTLLKTKAEQKQNIQ
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcaattcaatacgaaaaaaatgccgacaatattgtcattttaacgcttgattca
actggtcagcctgcaaataccatgaatgcagaatttcgtgactcgcttgatgaggtcacc
cagaaacttaaagcagaaacagagctttcaggtgttatttttcgctcagcaaaaaaaact
ttctttgctggtggtgatttagatgaactgattcaaattcaacctgagcatgcaactgac
tttttcaatatggttgagaagttaaaaggtcatctaagaacgattgaaacactagggatt
cccgtggttgcagcattgaatggcacggcactgggcggaggatgggaaatcgcattaagt
tgccatcaccgtattgcaatcaatgacccgaaaagcaaatttggcctaccagaagttacc
ttaggtttactaccgggcggcggtggtattgtacgtatggtccgtctgcttggtcttcaa
aatgcattcccatttttaatggaaggtaagcagttcggtgtcgataaagccaaatcttta
ggcttaattcatgacacagctgaaaatgaacaagaacttttagataaagcgattgcttgg
atcaaagctaatccaaaatctcaacagccttttgatgtgaagggttataaaattccgggt
ggtgatccaaaaactccggcagttgcacaagttctcgctattgcaccagccatgttaaaa
gacaaaaccaagggctgctatcctgctcctgaagcgattatggctgccgcagttgaaggt
gctcaagttgatgttgatactgcgttgcgcatcgagtctcgctactttactcaattagca
acaggccaaatttctaaaaatatgattggcactttctggcatggtctaaatgcaattaag
tcgggtgctagccgtcctgccgatattgcaaaatggcaagccactaaagtgggcgtgttg
ggtgcgggcatgatgggtgccggtattgcctacgccactgcaattaaaggcattcctgtt
attcttaaagatgtatctgttgaaaatgctgaaaaaggcaaagcttattctcagaaattg
ctagataaacgtgtttcacaaggccgcatgacggcagaaaaacgtgatcagattttatcg
ctcattacggccactgcttctgctgaagacttacaaggttgtgacctgattattgaagcc
gtatttgaaaaccaagagctcaaagcgaaagtcactcaagaagctgaacaatacttagcg
cctaatggtgtaatagcatcaaatacatccaccctaccgattacaggtttagcgcaagca
agcaagaatgataaagcatttatcggtctgcatttctttagccctgtcgacaaaatgcag
ttggttgagattattaaaggtaaaaatacctccgcagagacacttgctaaagcctacgac
tttgtacagcaaattggaaaaacgccaatcgttgtcaatgatagccgtggcttctttacc
agtcgtgtgtttggtacttttattcaagaaggtatgcgcttacttgcagaaggcgtccat
ccagcgcgtattgaaatggcagcactgaaagctggcatgccggtaggaccacttgcgatt
caagatgaagtgtctttaactttgaccgagcatgttgctagtgaagcacgtaaagcgctg
caagccgaaggcaaagagctaccgaaaacaccagtagatgaagtgattcataccatgatt
catgagttaaatcgtaaaggtaaagctgctggcgcaggtttttatgattatcctgaaaat
ggtaaaaagcacctatgggaaggcttaaaccgctggcagaaagatcacgatatttctgag
caggatatgatagatcgcattttgtttgtacaagccttagataccttacgttgttatgaa
gaaggggtattagagtcagtgattgatgccaatgtcggttctatttttggaattggttat
gctccgtggacgggaggagcaattcaattcttaaatcaatatgggattgataaagcacaa
aaacgtgccgaagagttggctgccaaatatggtgagcgcttcacgcccccaacgttacta
aaaactaaagctgagcagaagcaaaatattcaataa

DBGET integrated database retrieval system