KEGG   Acinetobacter baumannii SDF: ABSDF0706Help
Entry
ABSDF0706         CDS       T00660                                 

Definition
lysozyme from bacteriophage (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
abm  Acinetobacter baumannii SDF
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
650961..651524
Genome map
AA seq 187 aa AA seqDB search
MNPMTTKPFFDAARVIAGGKLTQAQVDELNKVVDKLAPGGKTISDVGVDLISGFEDTRFK
AYDDGVGVWTIGTGTTVYPNGVKVKQGDICTPEQAKTYFKHDLTKFEKTVNESVTVPLNQ
NQFDALVSLTYNIGAGALKNSTLLKLLNKGDYKGAADQFLVWNKAGGKVMKGLVRRREAE
RALFLKK
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
gtgaatccaatgacaactaaaccattctttgatgctgctcgagttatcgcaggcggcaag
cttacacaagcacaagtggatgaactaaataaggtggtcgataaacttgcgccaggtgga
aaaactataagtgatgttggtgtagatctaatctcaggatttgaagacacacgtttcaaa
gcttatgacgatggtgtgggagtctggaccattggcactggcaccacagtttatccaaat
ggtgtgaaggttaagcaaggtgacatttgcacacctgagcaggctaagacttacttcaag
catgacctaactaaatttgaaaagactgtaaatgaatctgtgacagtgcccctaaatcaa
aatcagtttgatgctttggtttctctgacttacaacattggcgcaggtgctttaaagaat
tcaactttgctcaagttgcttaataaaggcgactacaaaggcgctgctgaccaattcctt
gtatggaacaaagcaggtggcaaagttatgaaaggtctagttcgtcgccgagaagcagag
cgagcactctttttaaagaagtaa

DBGET integrated database retrieval system