KEGG   Acinetobacter baumannii SDF: ABSDF0756Help
Entry
ABSDF0756         CDS       T00660                                 

Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
abm  Acinetobacter baumannii SDF
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:abm00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    ABSDF0756
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABSDF0756
  Lipid metabolism
   00071 Fatty acid degradation
    ABSDF0756
  Amino acid metabolism
   00350 Tyrosine metabolism
    ABSDF0756
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ABSDF0756
   00626 Naphthalene degradation
    ABSDF0756
Enzymes [BR:abm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ABSDF0756
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(696438..697622)
Genome map
AA seq 394 aa AA seqDB search
MAKPYYEFFCPVKVIAGNAALEHIPFELATLGAKRPLIITDKGVRANGLLNPIEAAFSTT
DAVIGHVFDDVPPDSSLEVVRLAAEAYRTNKCDAIIAVGGGSVIDTSKATNILVSEGGDD
LLQYSGAHNLPKPLKPFFVIPTTSGTGSEVTMVAVVSDTQKNVKLAFASYYLMPHAAILD
PRMTLTLPPHLTAMTGMDALTHCVEAYTCMAANPLSDAYASAGIKKISENLFNVLENPND
SQGRLELAQASTMAGIAFSNSMVGLVHSLGHALGAVAHLPHGLCMNLFLPYVLEYNKQIN
GQKIGELLLPLAGADIYAQTPATQRADRAIATILAMRDRLFSLTKLPRTLRETGKVTEAQ
LDEVAEKALNDGSIIYNPKEASLKDLREILQKAW
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaccatattacgaattcttttgtcctgtaaaagtcattgccggtaatgctgct
ttagaacatattccgtttgaacttgcgactttaggtgcaaaacgccctcttatcattacc
gataaaggtgttcgtgcaaatggcttgttaaaccctattgaagctgcttttagcacaact
gatgcagtcattggtcatgtttttgatgatgttccaccagactcaagtcttgaagttgtt
cgacttgctgcggaagcttatcgcacaaataaatgtgatgcgattattgctgtgggcggt
ggttctgttatcgatacctctaaagcaactaacattttagtatcagaaggtggagatgat
ctacttcaatattctggtgcacacaacctaccaaaaccattaaaaccatttttcgtcatc
ccgactacatcaggtacgggatctgaagtgaccatggttgctgttgtgtctgatacacaa
aagaatgttaaattggcatttgcttcatattacttaatgccacatgctgcgattttagat
ccacgcatgacattaacgttaccacctcacttaactgcaatgacgggcatggatgcgtta
acacattgtgttgaagcatacacctgtatggcagctaacccgcttagcgatgcttatgca
agtgcaggtattaaaaagattagcgaaaatctatttaatgttttagaaaatccaaatgac
tcacaaggtcgtttagaacttgcacaagcttctacaatggcaggtatcgcattctctaac
tcgatggtaggccttgtacactcattaggacatgcattaggtgcagttgctcacctgccc
cacgggctgtgcatgaacttattcttaccttatgtgcttgagtacaataaacaaatcaat
ggtcagaaaattggcgagttgctattaccacttgcaggtgccgatatttatgcccagact
cctgctactcagcgtgcagacagagcaatcgcaactattttagcaatgcgtgatcgttta
tttagcttaaccaaattaccacgtaccttacgtgaaacaggtaaagttactgaagcacag
cttgatgaagtggcagagaaagcactaaatgatggctcaattatttataatcctaaagaa
gcaagcttaaaagatctacgagagatcttacaaaaagcttggtaa

DBGET integrated database retrieval system