KEGG   Acinetobacter baumannii SDF: ABSDF0776Help
Entry
ABSDF0776         CDS       T00660                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoamide succinyltransferase, component of 2-oxoglutarate dehydrogenase complex (E2)
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
abm  Acinetobacter baumannii SDF
Pathway
abm00020  Citrate cycle (TCA cycle)
abm00310  Lysine degradation
abm01100  Metabolic pathways
abm01110  Biosynthesis of secondary metabolites
abm01120  Microbial metabolism in diverse environments
abm01130  Biosynthesis of antibiotics
abm01200  Carbon metabolism
Module
abm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
abm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:abm00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ABSDF0776 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    ABSDF0776 (sucB)
Enzymes [BR:abm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     ABSDF0776 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding DUF5304 GCV_H OmpA
Motif
Other DBs
NCBI-ProteinID: CAP00148
UniProt: B0VSK8
Position
716438..717634
Genome map
AA seq 398 aa AA seqDB search
MATEIKAPVFPESVADGTIATWHKKVGEPASRDEVICDIETDKVVLEVVAPADGSLVAII
KGEGDTVLSDEVIAQFEAGAGAAAAAPAAVEQAVAQTQAGAAPVVERNETVSDQAPAVRK
ALTESGIAASDVQGTGRGGRITKEDVANHQAKPAANVTPLSVAVGERIEKRVPMTRLRKR
VAERLLAATQETAMLTTFNEVNMKPIMELRKQYKDAFEKRHGARLGFMSFFVKAATEALK
RYPAVNASIDGDDIVYHGYYDIGVAVSSDRGLVVPVLRDTDRMSYAEVEAGIAAYAAKAR
DGKLSIEEMTGGTFTITNGGTFGSLLSTPILNQPQTGILGMHKIQERPMAVNGQVEILPM
MYLALSYDHRMIDGKEAVGFLVAIKELLEEPAKLILDL
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccgaaattaaagcaccggtattcccagagtctgttgcagatggaaccatcgca
acttggcataaaaaggtgggtgaacctgcatcacgtgatgaggtaatctgtgatattgaa
accgacaaagttgttttagaagttgttgctcctgcagatggtagcttagttgcaatcatt
aaaggtgaaggcgatacagttctttctgacgaagttattgctcaattcgaagctggtgct
ggcgcagcggctgctgctcctgcggcagtagaacaagcagttgctcagactcaagctggt
gctgctcctgttgttgagcgtaatgaaactgtatctgatcaagctcctgcagtacgtaaa
gcgttaactgaatctggtattgctgcttctgacgtacaaggtactggtcgtggtggtcgt
atcactaaagaagatgttgcaaaccatcaagctaaaccagctgctaacgttactccatta
agcgttgctgttggcgaacgtatcgaaaaacgcgttccaatgactcgtttacgtaaacgt
gtagctgagcgtcttcttgcagctactcaagaaacagcaatgttaactacatttaacgaa
gttaacatgaagccaatcatggaattacgtaagcaatataaagatgctttcgaaaaacgt
catggtgctcgtttaggcttcatgtcattcttcgttaaagcagcaactgaagcgctaaaa
cgctacccagctgtaaatgcttcaattgatggcgatgatatcgtttatcacggttactat
gacatcggtgttgcagtatcttctgatcgtggtcttgttgtaccagtattacgtgatact
gaccgtatgagctatgcagaagtagaagcaggtattgctgcttacgctgctaaagcacgt
gatggtaaattatctatcgaagaaatgactggcggtactttcacgatcactaacggtggt
actttcggttcattactttcaactccaattttgaaccagccgcaaactggtatcttgggt
atgcataaaatccaagaacgtcctatggcggtaaatggtcaagttgaaatcttgccaatg
atgtacttagcgctttcttatgaccatcgtatgatcgatggtaaagaagctgtaggtttc
ttagttgcaatcaaagaattgttagaagaaccagctaaactcattcttgatctttaa

DBGET integrated database retrieval system