KEGG   Acinetobacter baumannii SDF: ABSDF0916Help
Entry
ABSDF0916         CDS       T00660                                 

Gene name
ruvA
Definition
(GenBank) holliday junction helicase subunit A
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
abm  Acinetobacter baumannii SDF
Pathway
abm03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:abm00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ABSDF0916 (ruvA)
Enzymes [BR:abm01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     ABSDF0916 (ruvA)
DNA repair and recombination proteins [BR:abm03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     ABSDF0916 (ruvA)
    RecFOR pathway proteins
     ABSDF0916 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvA_N HHH_5 RuvA_C HHH IMS_HHH HHH_3 5_3_exonuc DNA_pol_lambd_f Transposase_20 Ribosomal_S13
Motif
Other DBs
NCBI-ProteinID: CAP00277
UniProt: B0VT90
Position
complement(847747..848346)
Genome map
AA seq 199 aa AA seqDB search
MIGCLIGEVFALEAPTVLLNVNGVGYEIDTPLSTFCQLQKGQKVTLWTHLVIREDAQQLY
GFSDAQEKTIFRTLLKVNGVGPKMALGILSTLSVELLVHTIEHDDVNTLVKVPGVGKKTA
ERLMIELRDRFKTLAQGTSSAAALPQIQFVSNSPVAEAEAALQSLGYKPLEAQKAVAAVK
ADYTESADIIRAALKSMMK
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgatcggatgtttaattggcgaagtgtttgccctagaagccccaactgtcttactgaat
gtaaatggtgtgggctatgaaattgatacaccactttcaacattttgccaattacaaaaa
ggccagaaagttacgctatggacgcatttggtcatccgtgaagatgctcagcagctttat
ggttttagtgatgctcaagagaaaactattttccgcaccttactaaaagtaaatggtgtg
ggcccgaaaatggcattaggtattctttctacgttaagtgttgaattgctggtacacaca
attgaacatgacgatgtgaatactttggttaaagttccaggtgtaggcaaaaaaacagct
gaacgtttaatgattgaacttcgtgaccgttttaaaactttggcacaaggaacttctagc
gctgccgccctgcctcagattcaatttgtttcgaactcacctgttgcagaagcagaagca
gccttacagtcactaggttataaacctctagaagcacaaaaagctgttgcggcggttaaa
gccgattacactgaatcagccgatattattcgtgctgcacttaaatcaatgatgaagtaa

DBGET integrated database retrieval system