KEGG   Acinetobacter baumannii SDF: ABSDF1162Help
Entry
ABSDF1162         CDS       T00660                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase (IGPS)
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
abm  Acinetobacter baumannii SDF
Pathway
abm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
abm01100  Metabolic pathways
abm01110  Biosynthesis of secondary metabolites
abm01130  Biosynthesis of antibiotics
abm01230  Biosynthesis of amino acids
Module
abm_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:abm00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ABSDF1162 (trpC)
Enzymes [BR:abm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     ABSDF1162 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: CAP00512
UniProt: B0VUS0
Position
complement(1074225..1075031)
Genome map
AA seq 268 aa AA seqDB search
MINIQNTILGKIVDRKHEDLAARLKQRNLQDVEELAKAATPVRGFANALQHKRPGVIAEI
KKASPSKGIIRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIARNHCTLPALR
KDFLVDPYNVVEARALHADCILLIVACLSDQQLEEMSKTAFEHQLDVLVEVHDEEELERA
LKLSEQCLLGVNNRNLKTFDVDLNTTIRLKKLLPASRLLITESGIATPDDVRMMQEHDIH
SFLVGESFMKQPRPDQAFTALFGQPQTV
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgattaatattcaaaataccattttaggtaaaattgttgaccgtaaacatgaggatctt
gctgcgcgtttaaaacaacgtaatttgcaagatgtagaagagcttgcaaaagcagcgact
ccggtgcgtggctttgcaaatgctttacaacataaacgtccgggcgtgattgctgaaatt
aaaaaagcatctccatcaaaaggaatcattcgcgcagactttaatcctgccgaaattgct
cagcaatatgaacaagctggagcagcatgtttatcggtattgaccgatgttgatttcttt
cagggtgcagatgaaaatattgcgattgcccgtaatcattgtaccctacctgctttacgt
aaagactttttggtcgacccgtacaatgtagttgaagcacgtgctttgcatgctgactgt
attttattaattgttgcttgtttgtctgaccagcaactcgaagaaatgtctaaaactgcg
tttgagcatcaacttgatgtattggttgaagtccatgacgaagaagagttagagcgtgcc
ttaaagctttctgagcaatgtttattaggcgtaaataaccgtaatttaaaaacctttgat
gtagatttaaatactactattcggttgaaaaaattacttccggcctcacgtttattgatc
actgaaagtggtattgcgacaccagatgatgtacgtatgatgcaagagcatgatattcac
agtttcttggttggcgaaagttttatgaaacaaccacgtccagatcaagcttttactgcc
ctttttggacaacctcaaacggtttaa

DBGET integrated database retrieval system