KEGG   Acinetobacter baumannii SDF: ABSDF1591Help
Entry
ABSDF1591         CDS       T00660                                 

Definition
(GenBank) putative acetyl-CoA synthetase/AMP-(fatty) acid ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
abm  Acinetobacter baumannii SDF
Pathway
abm00010  Glycolysis / Gluconeogenesis
abm00620  Pyruvate metabolism
abm00640  Propanoate metabolism
abm00680  Methane metabolism
abm01100  Metabolic pathways
abm01110  Biosynthesis of secondary metabolites
abm01120  Microbial metabolism in diverse environments
abm01130  Biosynthesis of antibiotics
abm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:abm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABSDF1591
   00620 Pyruvate metabolism
    ABSDF1591
   00640 Propanoate metabolism
    ABSDF1591
  Energy metabolism
   00680 Methane metabolism
    ABSDF1591
Enzymes [BR:abm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     ABSDF1591
Lipid biosynthesis proteins [BR:abm01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   ABSDF1591
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: CAP00931
UniProt: B0VM31
Position
1491075..1492715
Genome map
AA seq 546 aa AA seqDB search
MKTLAEAYRQFDLTRLIEEQLVGHPQAINAYVECCERYVGKNKTALIWEGKNGQAEYYTF
EQLAELSGKLANFFKAQGIQAGDCIAGLLPRTPELLITILAAWRIGAIYQPLFTAFEAKS
IDHRITTAQTKLIVTNDEQRPKLNSLNVPVIVTVHQTGLLSEHDFDFWQSLQRYSEQCEP
VNRSVDDDFLMMFTSGTTGLAKSVPVPLKAILAFKGYMTHAVDLREEDMFWNLADPGWAY
GLYYGITGPLSLGHSIIMDERSFNVDQAMELIKKYKVSNLTGSPTAFRMFFGFKEKFDPS
IKQHLRVVSSAGEPLTPEVVNWFKQDLEVNIFDQYGQTELGMVIANHHALEHPLKVGSAG
FAIPGHRFAVLDQNYQELPTGGVGILAMDSEQSPLMWFKGYGGNNRKSFVGKYYLTGDTV
TLNEHGGIGFVGRADDVITTSGYRVGPFDVESTLLECEAVLESAVIGKPDPERTEIVKAF
VVLKPAYQACETLKDKLQQYVRNRLSRHAYPKEIEFVDSLPKTTSGKIQRGLLKQQEIAK
MQPYAS
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactttggcagaagcttatcggcaatttgatcttacaaggctcatcgaagagcaa
cttgttgggcatccccaagcaataaatgcttatgttgagtgctgtgagcgttatgtagga
aaaaataagacagcgcttatctgggaaggaaaaaatgggcaggcagagtactatacgttc
gaacaacttgctgaactttctggaaaacttgctaacttctttaaagcacaaggaattcaa
gctggagattgtattgcaggacttctaccaagaacgcctgagttattaattacaattttg
gcagcatggcgtataggtgctatttatcagcctttatttactgcctttgaagcaaaatcg
attgatcaccgtattactactgctcaaactaaattgattgtgaccaatgatgaacagcgt
cctaaactgaatagcttgaatgttccggttattgtcactgttcatcaaacaggtctttta
tctgagcatgactttgatttttggcaatctttacaacgctattctgagcaatgtgagcca
gtaaatcgtagcgttgatgatgactttttaatgatgtttacttctggcacaactggactt
gcgaagtctgtacctgttccactaaaagcaattttggcatttaaaggttatatgactcat
gctgtcgatttgcgtgaagaggatatgttctggaatctggcagatccgggctgggcgtat
ggattgtattatggcattactggccctttaagcttggggcatagcattattatggatgag
cgttcatttaatgtagatcaggcaatggaattaattaaaaaatataaagtaagtaattta
acaggatcgcctacagcatttcgcatgttctttggttttaaggaaaaatttgacccttca
attaaacaacatttacgcgtagtgagcagtgcaggtgagccattaactcctgaggttgtg
aactggtttaagcaggatttagaggtcaatatttttgatcaatatggccaaactgagtta
gggatggtgattgcaaatcatcatgctcttgagcatccattaaaagtaggttcagctggt
tttgcaatacctggacatcgttttgcggtgttagaccaaaattatcaagaattgccaact
ggtggtgttggtattttggcaatggactcggagcaatctccattgatgtggtttaaaggc
tatggcggcaataatcgaaaatcgtttgttggtaagtattatttaacaggtgacacggtc
actttaaatgaacatgggggcattggttttgtggggcgtgctgacgatgtcattacaact
tcgggctatagagttggaccatttgatgttgaaagtactttattagagtgtgaggccgta
ttagagtcagcagtaattggtaagccagatccggaacgaaccgaaatagtcaaagctttt
gtggtacttaagcctgcttatcaagcgtgtgaaacattaaaagataagttacagcaatat
gttcgtaaccgtttatctcgtcatgcttatccaaaagagattgagtttgtggacagtcta
ccgaaaaccacgagcggaaaaattcaaagaggactgttgaagcagcaagaaattgcaaaa
atgcagccctacgcaagctaa

DBGET integrated database retrieval system