KEGG   Acinetobacter baumannii SDF: ABSDF1596Help
Entry
ABSDF1596         CDS       T00660                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
abm  Acinetobacter baumannii SDF
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:abm00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1495994..1496431
Genome map
AA seq 145 aa AA seqDB search
MNAPETIFALALASNLDAAQHFTFAYTQLATLGKVQFSSVYQITCRDGIGDDYWNSACLL
KSTLSSEQIESFLKKLESDSGRVRPSHHISLDVDLIAWGSDLDHMQFNSKKLPLALDVKI
PLYELWDCETLKADSTLYPVVNFKV
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
ttgaacgcaccagaaacaatttttgcgctcgctctagcgagtaatttagacgcagcacaa
cactttacttttgcttatacgcaattagcaactttggggaaagtgcagttttcatctgtt
tatcaaattacatgccgagatggtattggagatgattactggaactcagcgtgtctatta
aaaagcaccttatcatctgaacaaattgaatcttttttaaagaaacttgagtcagattct
gggcgtgttcgaccatcacatcatatttctttagatgtagatttgattgcatggggaagt
gatctggaccatatgcaatttaattctaaaaaattgccgttagcactcgatgtaaaaatt
cctttatatgaactttgggattgtgaaaccttaaaggctgatagcacactttatccagtc
gttaattttaaagtttaa

DBGET integrated database retrieval system