KEGG   Acinetobacter baumannii SDF: ABSDF1596Help
Entry
ABSDF1596         CDS       T00660                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
abm  Acinetobacter baumannii SDF
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:abm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ABSDF1596
Enzymes [BR:abm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     ABSDF1596
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1495994..1496431
Genome map
AA seq 145 aa AA seqDB search
MNAPETIFALALASNLDAAQHFTFAYTQLATLGKVQFSSVYQITCRDGIGDDYWNSACLL
KSTLSSEQIESFLKKLESDSGRVRPSHHISLDVDLIAWGSDLDHMQFNSKKLPLALDVKI
PLYELWDCETLKADSTLYPVVNFKV
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
ttgaacgcaccagaaacaatttttgcgctcgctctagcgagtaatttagacgcagcacaa
cactttacttttgcttatacgcaattagcaactttggggaaagtgcagttttcatctgtt
tatcaaattacatgccgagatggtattggagatgattactggaactcagcgtgtctatta
aaaagcaccttatcatctgaacaaattgaatcttttttaaagaaacttgagtcagattct
gggcgtgttcgaccatcacatcatatttctttagatgtagatttgattgcatggggaagt
gatctggaccatatgcaatttaattctaaaaaattgccgttagcactcgatgtaaaaatt
cctttatatgaactttgggattgtgaaaccttaaaggctgatagcacactttatccagtc
gttaattttaaagtttaa

DBGET integrated database retrieval system