KEGG   Acinetobacter baumannii SDF: ABSDF1811Help
Entry
ABSDF1811         CDS       T00660                                 

Definition
lysozyme from bacteriophage (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
abm  Acinetobacter baumannii SDF
Brite
Enzymes [BR:abm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     ABSDF1811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1683399..1683962
Genome map
AA seq 187 aa AA seqDB search
MNPMTTKPFFDAARVIAGGKLTQAQVDELNKVVDKLAPGGKTISDVGVDLISGFEDTRFK
AYDDGVGVWTIGTGTTVYPNGVKVKQGDICTPEQAKTYFKHDLTKFEKTVNESVTVPLNQ
NQFDALVSLTYNIGAGALKNSTLLKLLNKGDYKGAADQFLVWNKAGGKVMKGLVRRREAE
RALFLKK
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
gtgaatccaatgacaactaaaccattctttgatgctgctcgagttatcgcaggcggcaag
cttacacaagcacaagtggatgaactaaataaggtggtcgataaacttgcgccaggtgga
aaaactataagtgatgttggtgtagatctaatctcaggatttgaagacacacgtttcaaa
gcttatgacgatggtgtgggagtctggaccattggcactggcaccacagtttatccaaat
ggtgtgaaggttaagcaaggtgacatttgcacacctgagcaggctaagacttacttcaag
catgacctaactaaatttgaaaagactgtaaatgaatctgtgacagtgcccctaaatcaa
aatcagtttgatgctttggtttctctgacttacaacattggcgcaggtgctttaaagaat
tcaactttgctcaagttgcttaataaaggcgactacaaaggcgctgctgaccaattcctt
gtatggaacaaagcaggtggcaaagttatgaaaggtctagttcgtcgccgagaagcagag
cgagcactctttttaaagaagtaa

DBGET integrated database retrieval system