KEGG   Acinetobacter baumannii SDF: ABSDF1831Help
Entry
ABSDF1831         CDS       T00660                                 

Gene name
cysQ
Definition
(adenosine 3'-phosphate 5'-phosphosulfate) 3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
abm  Acinetobacter baumannii SDF
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:abm00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    ABSDF1831 (cysQ)
Enzymes [BR:abm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     ABSDF1831 (cysQ)
Transfer RNA biogenesis [BR:abm03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    ABSDF1831 (cysQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1707317..1708174
Genome map
AA seq 285 aa AA seqDB search
MFITTTRPNDVLIEQLLPILEEASQILLQEYQNYSAGYEFTIQEKHDDSPVTQADLKVNR
FLLKHLAEITPELPVLSEESDYSARHAWSSCWMLDPLDGTKEFIHERDEFTINLSLIEGR
ETIFSVIVVPCEQVVYLGYLKDLPFKYSFSQQQWYQYQKTPYSTQAPVQIGLSHSSKNPK
YQKFIEPIEKIRTVIRREAGSAYKFCMMLEGEIDIYPRFHPTSEWDTSSGQGLLESIGGG
LLTLTGKPFEYNQRDTVLNGGFIAFRDQESKKIAFEALAQSGVLD
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgtttataacaacaactcgccccaatgatgttttaattgaacagttactaccaatcttg
gaagaagctagccaaatcttattacaagaatatcaaaattattcggctggatatgagttt
acgattcaagaaaaacatgacgactcacctgtaacgcaagcagatttaaaggtaaatcgt
tttttattaaagcatcttgcagaaattacacctgagttaccggttttatcggaagaaagt
gactatagcgctcgccatgcttggtcttcttgctggatgctagatccacttgatggtacg
aaagagtttatacatgagcgagatgagttcacgataaacttgagtttgattgaagggcgt
gaaacgattttttcggtgattgttgtgccatgtgagcaagttgtttatttaggttattta
aaagatttaccttttaaatatagctttagccaacaacaatggtatcaatatcaaaaaaca
ccttattcaacacaagcacctgtacaaatcggtttaagtcatagtagtaaaaatccaaaa
tatcagaaattcattgaacctattgaaaagattcgtaccgtaattcgacgtgaagcaggt
agcgcttataagttttgtatgatgttagaaggcgagatcgatatttatcctagatttcat
ccgacatcagaatgggataccagctcaggtcaaggattattagaaagtataggtggaggt
ttactcactctaacaggtaaaccctttgaatataaccagcgtgataccgtattaaatggg
ggctttatcgcatttcgtgatcaggaaagcaaaaaaatagcatttgaagctttagctcaa
tcaggtgttttggattga

DBGET integrated database retrieval system