KEGG   Acinetobacter baumannii SDF: ABSDF1915Help
Entry
ABSDF1915         CDS       T00660                                 

Gene name
recR
Definition
(GenBank) recombination protein, gap repair
  KO
K06187  
recombination protein RecR
Organism
abm  Acinetobacter baumannii SDF
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:abm00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ABSDF1915 (recR)
DNA repair and recombination proteins [BR:abm03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     ABSDF1915 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      ABSDF1915 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1778466..1779062
Genome map
AA seq 198 aa AA seqDB search
MFSDRFEQLVQALRILPSVGPKSAQRMALHLLMKNREGAFALAHALHEASSYIHECSVCH
SLTEHEICDICASTERDDQLLCVVESPADVMAIEQSGSFRGKYHVLGGHLSPLDGIGPEE
IGIPYLIQRLSQGTIEEVILATNATVEGQATAHYLVEATKHLPIHMTRIAQGVPQGGELE
YVDSHTLSQAVHNRMRMK
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
gtgtttagcgatagatttgaacaactcgttcaagctttacgtattttgcctagcgttgga
ccgaagtcggcccaacgtatggctttacatctcttgatgaaaaatcgtgaaggtgcattt
gctttagcacatgctctacatgaagcatcaagttatattcatgaatgtagtgtttgccac
tctttaacagagcatgaaatttgtgatatttgcgcttcaacagaaagagatgatcaattg
ctttgtgtagttgagtctccggcagatgttatggcaatcgagcaaagtggtagttttcgt
ggcaaataccatgtgttgggtggacacctttctccattagatggaatcgggccagaagaa
ataggcattccttatctaatccaacgtttaagccaaggtacgatcgaagaagtcattttg
gcaactaatgctactgtggaaggtcaggcgacagcgcattatttggttgaagcgacgaag
catttacctattcacatgacacgtattgctcaaggcgtaccacaaggtggcgagcttgaa
tatgtggatagtcataccttaagtcaggctgttcataaccgtatgcgtatgaaataa

DBGET integrated database retrieval system