KEGG   Acinetobacter baumannii SDF: ABSDF1927Help
Entry
ABSDF1927         CDS       T00660                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
abm  Acinetobacter baumannii SDF
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:abm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ABSDF1927 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ABSDF1927 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ABSDF1927 (trpB)
Enzymes [BR:abm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ABSDF1927 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1787273..1788478
Genome map
AA seq 401 aa AA seqDB search
MQHQINGIALPNEQGFFGEYGGQFIPPHLKEAMDEINVAYEEIRHTPEFQNELADLFANY
VGRPSPLFHAKRLSEQLGGAQIYLKREDLNHTGAHKINHCLGEALLAKYMGKKKVIAETG
AGQHGVALATACALVGIPCEIHMGQVDIEKEHPNVVKMKILGAHLVSVTRGTATLKDAVD
SAFEEYLKDPKNFIYAIGSVVGPHPFPKMVRDFQSIIGKEIKEQTHQRFGKNPDYVVACV
GGGSNAIGAFTAFLNDSDVKLVGVEPAGHGLDTNMHSATLTLGKPSQIHGMACYVLENEA
GEPLPVHSIASGLDYPGVGPQHSFLKDLGRVEYSTATDQECLDAFMTLSRVEGIVPALES
SHAVAWAIREAPKLPKETMIVVNLSGRGDKDSDYVAEKLKL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgcaacatcaaattaatggtattgctttaccaaatgaacaaggattttttggtgagtat
ggaggtcagtttattcctccgcatttaaaagaagcaatggatgaaattaatgttgcttat
gaagaaattcgccatacaccagaatttcaaaatgaattagcagacctctttgcaaattat
gtcggccgtccaagtcctttatttcatgcaaaacgcctttcagaacagttaggtggcgcg
caaatttatttaaaacgtgaagacttaaatcataccggtgcccataaaattaatcactgt
ttaggtgaggctctacttgctaaatatatgggcaaaaagaaagttatcgccgagactggt
gcgggtcaacatggggttgctttagcaactgcttgtgctctagtgggtattccatgtgag
atccacatgggtcaagttgatattgaaaaagaacatccaaatgtggtcaaaatgaaaatt
ttgggcgcccatttggtgtcagtaactcgcggtacagcaaccttaaaagatgcggttgat
agcgcgtttgaagaatatttaaaagatcctaaaaattttatttatgcgattggttctgtg
gttggtccacatccatttcctaaaatggttcgagattttcaatcaattattggtaaggaa
attaaagagcagacgcatcaacgatttggtaaaaacccagattatgttgtcgcatgtgtc
ggtggcggttcaaatgcaatcggtgcgtttacagcttttttaaacgattcagatgtgaaa
cttgtaggagttgaacctgctgggcatgggctagatacaaatatgcattcggcaacccta
acattaggtaaaccgagccaaattcatggtatggcatgttatgttcttgaaaatgaggct
ggtgaacctttacctgtgcattctatcgcttcaggattggactatcctggtgttgggcca
caacatagtttcttaaaagatttaggccgtgtggaatatagcactgcaactgaccaagaa
tgtttagatgcgtttatgaccttatcacgagttgaaggtattgttcctgcgcttgaaagc
tcacatgctgtcgcatgggcaatacgtgaagcgccaaaactgccgaaagaaaccatgatc
gtggtgaatctgtcgggtcgtggcgataaagattctgattatgtggcagaaaaacttaag
ctttaa

DBGET integrated database retrieval system