KEGG   Acinetobacter baumannii SDF: ABSDF2205Help
Entry
ABSDF2205         CDS       T00660                                 

Definition
iron-containing alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
abm  Acinetobacter baumannii SDF
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:abm00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    ABSDF2205
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABSDF2205
  Lipid metabolism
   00071 Fatty acid degradation
    ABSDF2205
  Amino acid metabolism
   00350 Tyrosine metabolism
    ABSDF2205
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ABSDF2205
   00626 Naphthalene degradation
    ABSDF2205
Enzymes [BR:abm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ABSDF2205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2027319..2028476
Genome map
AA seq 385 aa AA seqDB search
MNHFQFQTVPNIISGLGSIQELQNVLASKTYRKLLLVTDAGMIKNQLHLPILQILDTLKI
EHVIYADVQADPPEQVVLDAANYAKQQNVDVIVGFGGGSSLDVAKVIALLAHPNQTQNLQ
EMYGVNQVKTARLPLILIPTTAGTGSEVTPISIVTTGETTKMGIVSPVLYADTAILDATF
TQNLPAHITAATGIDAMVHAIEAYTSKHKKNIYTDILAKHALKLLNHNLPKVLKNGNDLE
ARQNMLFGSMLAGQAFANSPVAAVHALAYPLGGHFHLSHGHTNALVLVEVLKFNAPYAKQ
YYAELMQWLDPYSNGSTDGLCDLFIDHMQNHLDRSGLTLKLSDLGIEESSLPRLAQDAML
QTRLLQNNPRDMTETAALAIYQAIY
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaaccattttcagtttcagaccgttcccaacattatttcaggactcggttctatacaa
gaattacagaatgtgttggcatcaaaaacttaccgcaagttattactggtaactgatgcg
ggtatgattaaaaatcagttacacctgcctattcttcaaattttagatactcttaaaatt
gaacatgtcatttatgctgatgttcaggccgacccaccagagcaagtggtattagatgca
gcgaattatgctaaacagcaaaatgtagatgttattgtcggctttggaggcggaagttct
ttagatgtagccaaagtgattgccttactcgcacatcctaaccaaactcaaaacctacaa
gaaatgtatggggtaaatcaggtcaaaacagcccgacttccacttattttaattcccact
acagccggtactggctcggaagtgacgcccatatcaatagtgactacaggtgaaacgaca
aaaatgggaattgtctctccggtactctatgccgatacagcaattcttgatgcaactttt
actcaaaatctacctgcccatattacggctgctacaggtattgatgcgatggtccatgcc
attgaggcatatacctctaaacataagaaaaatatttataccgatattttagcgaagcac
gctttaaagctgctaaaccataacttaccgaaagttcttaaaaacggtaatgatttagag
gcacgtcagaacatgctgttcggctcaatgcttgcgggtcaggcatttgcaaactcacct
gttgctgccgtgcatgctttagcctatccattgggtgggcattttcatttgtcgcatgga
cataccaatgctttggtgctcgttgaagtactgaaatttaatgcgccttatgccaaacaa
tactatgcagaacttatgcaatggctagacccatatagtaacggtagcaccgatgggtta
tgtgatctgtttattgaccatatgcaaaatcacttagaccgtagtggtttgactttaaaa
cttagcgatttgggtattgaagagtctagcttaccaagacttgctcaagatgccatgttg
caaactcgattactgcaaaataatccacgtgacatgacagaaacagctgctttagcaatt
tatcaggcgatttattaa

DBGET integrated database retrieval system