KEGG   Acinetobacter baumannii SDF: ABSDF2383Help
Entry
ABSDF2383         CDS       T00660                                 

Gene name
aceA
Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
abm  Acinetobacter baumannii SDF
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:abm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ABSDF2383 (aceA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    ABSDF2383 (aceA)
Enzymes [BR:abm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     ABSDF2383 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2204258..2205862)
Genome map
AA seq 534 aa AA seqDB search
MTTYQTAIDAVRELKAKFGNTWADISPEDAARMQLQNRFKTGLDIAKYTAAIMRRDMAEY
DADSSKYTQSLGCWHGFIAQQKMIANKKYFGTTSKRYIYLSGWMVAALRSEFGPLPDQSM
HEKTSVPALIEEIYTFLRQADAKELNDLFRALNKAKEAGDSAKVAEITAQIDNFETHVVP
IIADIDAGFGNEEATYLLAKKMIEAGACALQIENQVSDAKQCGHQAGKVTVPHEDFIAKI
HALRYAFLEMGVEDGVIVARTDSEGADLTQKIPVVKEPGDIASKYISYLDTQEIDISEAQ
EDEILIKRDGKLHRPTRLASGLYQFREGTQIDRVVLDCITSLQNGADLLWIETPTPNVQE
IAHMVNRVKEVVPNAKLVYNNSPSFNWTLNFRQQAYDRWVAEGKDVSAYDRAKLMSAEYD
NTELAAEADEKIRTFQADAAREAGVFHHLITLPTYHTAALSTHELAQGYFGDQGMLAYVA
GVQRKEIRGGIACVKHQAMAGSDIGDDHKEIFAGENALKAGDDAKNTMNQFSAH
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgactacatatcaaacagcgattgatgcagtacgtgaattaaaagcaaaattcggcaac
acttgggcagacattagcccagaagatgctgctcgtatgcaacttcaaaaccgtttcaaa
acaggtttagatattgctaagtatacagctgcgattatgcgtcgtgatatggctgaatac
gatgctgattcaagcaaatatactcaatcattaggttgctggcatggtttcatcgctcaa
caaaaaatgattgctaacaaaaagtatttcggtacgacaagcaaacgttatatctacctt
tctggttggatggttgctgctcttcgttcagaatttggtccacttcctgaccaatctatg
cacgagaaaacttcagtacctgctttgatcgaagaaatctacactttcttacgtcaagct
gatgcaaaagaattaaatgacttgttccgtgctttaaataaagcgaaagaagctggtgat
tctgcgaaagtagctgaaatcacagctcaaattgacaacttcgaaactcatgttgtgcca
attattgcagacatcgatgctggtttcggtaacgaagaagcaacttacttacttgctaag
aaaatgatcgaagctggtgcttgtgcgcttcaaatcgaaaaccaagtatctgatgcaaaa
caatgtggacaccaagctggtaaagtaactgttccacacgaagacttcatcgctaagatc
catgcacttcgttatgcattcttagaaatgggtgttgaagacggcgttatcgttgctcgt
actgactctgaaggcgctgacttaactcagaagatccctgtagttaaagagccaggtgat
atcgcatctaaatatattagctacttagatactcaagaaattgatatctcagaagctcaa
gaagatgagatcttaattaaacgtgatggtaaattacatcgtccaactcgtttagcttct
ggtctataccaattccgtgaaggcactcagattgaccgtgttgtacttgactgtatcact
agccttcaaaacggtgctgacttactttggatcgaaactccgactccaaacgtacaagaa
attgcacacatggttaaccgtgtaaaagaagtggttccgaatgcgaagcttgtttataac
aacagcccatcattcaactggactttaaacttccgtcaacaagcgtacgatcgttgggtt
gcagaaggtaaagatgtatctgcttacgaccgtgctaaattaatgagcgctgagtacgac
aatactgaattagctgctgaagctgatgaaaaaatccgtactttccaagcagacgctgcg
cgtgaagctggtgtgttccatcacttgatcacacttcctacataccacactgctgctctt
tctactcatgaattagcacaaggctacttcggtgaccaaggtatgttagcttatgttgct
ggcgtacaacgtaaagaaatccgtggtggtatcgcatgtgtgaaacaccaagcaatggct
ggttctgacatcggtgatgaccacaaagaaatcttcgctggtgaaaatgcacttaaagct
ggtgacgatgctaaaaacacaatgaaccaattctcagctcactaa

DBGET integrated database retrieval system