KEGG   Acinetobacter baumannii SDF: ABSDF2549Help
Entry
ABSDF2549         CDS       T00660                                 

Gene name
algC
Definition
phosphomannomutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
abm  Acinetobacter baumannii SDF
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:abm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABSDF2549 (algC)
   00030 Pentose phosphate pathway
    ABSDF2549 (algC)
   00051 Fructose and mannose metabolism
    ABSDF2549 (algC)
   00052 Galactose metabolism
    ABSDF2549 (algC)
   00500 Starch and sucrose metabolism
    ABSDF2549 (algC)
   00520 Amino sugar and nucleotide sugar metabolism
    ABSDF2549 (algC)
  Nucleotide metabolism
   00230 Purine metabolism
    ABSDF2549 (algC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ABSDF2549 (algC)
Enzymes [BR:abm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     ABSDF2549 (algC)
    5.4.2.8  phosphomannomutase
     ABSDF2549 (algC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2341375..2342793)
Genome map
AA seq 472 aa AA seqDB search
MNVRHSFPKNIFRAYDIRGKLSYLTTDVVRSIAYGLAQQYKQAEQTQLIIGYDARLTSPA
YAHLIEEILVEQGLNVTNIGCCSTPMMYYIAREFGGNGIMVTASHNPKSDNGIKWILRGE
PPSPEMIQQVGEFAQTYVPTHTISLLELSTPQFNSKFCKKYQQAIFNDIQLKRPLKVVLD
GLHGSAGHCSKLVLEKMGCEVIALRTTPNGEFPDHAPDPSHAAHLKELRKTIIEQGADIG
IALDGDGDRVVLLDEKANILTADRLLSLFAQMCLEQQPDKEIVFDVKCSLMVQRTVERLG
GKPKMIRTGSSFLRAYLSQSNGNAIFGGEYAGHYVFNDGRGFGYDDGLYAALRVMEYFTK
SSATTISDLFSNYPERCCTEDTYIGTHQSDPKHVLQDIEILSHRLGARISKIDGVRLDFD
DGFGIIRASNTGEYFTVRFDADNPLRLKEIQQKFIDMLQERYPQIAQELSEA
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtaagacactcatttccaaaaaatattttccgtgcttacgatattagaggcaaa
ctttcttatttaactacggacgtcgtccgttcaattgcctatggattggcacaacaatat
aaacaagcagaacaaactcaactgatcattggttatgatgcgcgcttaacgagtccggct
tatgcgcatttaatcgaagagatattagtagagcagggtttaaatgttacaaatattggt
tgttgctcaaccccgatgatgtactacattgcacgggagtttggtggtaatggtataatg
gtaacagctagccataaccctaaatcagataatggtattaaatggattttaagaggtgaa
cctccatctcctgaaatgatccagcaagtaggtgaatttgcgcaaacttatgtacctact
catacaatttcattattagaattatcaactcctcaatttaattcaaaattttgtaaaaaa
taccaacaagcaatctttaacgatattcaactcaagcgccctttaaaagttgtattagat
ggcctacatggatcggcagggcattgctcaaaactcgtacttgaaaaaatgggttgtgaa
gtcattgctttacgtacgactccaaatggtgagttccctgatcacgcaccagacccttca
catgctgcgcatttaaaagaactacgtaaaacgattattgaacagggggcagatattggt
attgcccttgatggcgatggcgaccgtgtcgtattacttgatgaaaaagccaatatactt
accgctgaccgtttattgtcactatttgcacaaatgtgtctggagcagcaaccagacaaa
gaaattgtatttgatgtgaaatgctcgctcatggttcaaagaaccgtagaacgacttggt
ggtaaacccaaaatgattcgcacgggaagtagcttcctccgcgcgtatttatctcaatca
aatggtaacgccatttttgggggcgaatacgcgggtcattatgtatttaatgatgggcgt
ggttttgggtatgacgatggtttgtacgctgcattacgtgtaatggaatatttcactaag
tcgagtgcgacaacaatttctgatttattttctaattatcctgaaagatgctgtaccgaa
gatacttatattggtacccatcagtccgaccctaaacatgtactacaagatattgaaatt
ttaagccatcgtttaggtgctcgaattagtaaaattgatggcgtacgtcttgattttgat
gatggttttggcattattcgagcatcaaatacaggcgagtattttaccgtaagatttgac
gctgataatcctttacgtttaaaggaaatccagcaaaaatttattgatatgttgcaagag
cgttatccgcaaattgcacaagaactttctgaggcctaa

DBGET integrated database retrieval system