KEGG   Acinetobacter baumannii SDF: ABSDF2841Help
Entry
ABSDF2841         CDS       T00660                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
abm  Acinetobacter baumannii SDF
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abm00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ABSDF2841 (murA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ABSDF2841 (murA)
Enzymes [BR:abm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     ABSDF2841 (murA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2604934..2606190)
Genome map
AA seq 418 aa AA seqDB search
MDKFLITGGVKLEGEVRISGAKNAALPLLAAMILADSPITLTNVPNLKDVNTLVKLIGGL
GVTISYENDTVKADTSTLDNQFAPYELVKTMRASILVLGPLLAHYGNAKVSLPGGCAIGS
RPVDQHLKALEALGAHIEVENGYVHATVDGRLKGGEVVFDMVTVGGTENILMAAALADGV
TTIRNAAREPEITDLAQMLIKMGAKIEGLDTDTLVVTGVESLHGCEYAVVADRIETGSYL
AAAAITGGRVKTTHTDPSLLEAVLDKFEEMGAEVTRGDDWIELDMLGKRPKAVSFRTLPH
PEFPTDMQAQIMAVNAIGRGFATISETIFENRFMHVPELSRMGANIQVEGHDAVVTGVEK
LQAAPVMATDLRASFSLVLAALVAEGDTLIDRIYHIDRGYEHVEEKLQGLGAKIKRVS
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggataaatttttaatcacgggcggtgttaagctcgaaggggaagtacgcatttctggt
gctaaaaatgcggctttaccgttacttgcggcaatgattcttgctgactctccaattaca
ttaaccaatgttccaaatcttaaagatgtaaatactttggtgaaattaattggtggacta
ggtgtcacaattagttatgaaaatgacacggttaaggcggatacttctactttagataac
cagtttgctccttatgagcttgtcaaaacaatgcgtgcatctattttggtattagggcca
ttattagcgcattacggaaatgccaaggtttcattacctggcggatgtgctattggctct
cgtccagtagatcaacacttaaaagccctagaagcattgggtgcacatatcgaagttgaa
aatggttatgtacatgccactgttgatggtcgtctgaaaggcggcgaagtggtttttgat
atggttaccgttggtggtaccgaaaatattttaatggcagctgctttggcagatggtgta
accacaattcgtaatgctgcacgtgaacctgaaattactgatcttgcgcaaatgcttatt
aaaatgggcgcaaaaattgaaggtttagatacggatacattggttgttactggtgtagaa
agtctacatggctgtgaatatgcagttgttgcagaccgcatcgaaacaggttcttactta
gctgctgctgcgattactggtggacgtgtaaaaaccacccatacagatccttcattgctt
gaggctgttttagataagtttgaagaaatgggtgctgaagtgacccgtggcgatgactgg
attgaattggatatgttggggaagcgtcctaaagcagtaagttttagaacactacctcac
ccagaatttccgactgacatgcaagcacaaattatggctgtaaatgcaattggtcgtggg
tttgcaacgatttccgagaccatttttgaaaatcgtttcatgcatgttcctgaattgtca
cgtatgggtgctaatattcaggtcgaaggccatgatgctgttgtaacgggtgttgaaaaa
ttacaagcagcacctgtaatggcaacagatttacgtgcttcattctctttggttttagcg
gctttggttgctgaaggtgatacattaattgaccgtatctaccatattgaccgtggttat
gagcatgtcgaagaaaaacttcaaggtttaggtgctaaaattaagcgagtaagttaa

DBGET integrated database retrieval system