KEGG   Acinetobacter baumannii SDF: ABSDF3053Help
Entry
ABSDF3053         CDS       T00660                                 

Gene name
folA
Definition
(GenBank) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
abm  Acinetobacter baumannii SDF
Pathway
abm00670  One carbon pool by folate
abm00790  Folate biosynthesis
abm01100  Metabolic pathways
Module
abm_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:abm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ABSDF3053 (folA)
   00670 One carbon pool by folate
    ABSDF3053 (folA)
Enzymes [BR:abm01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     ABSDF3053 (folA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: CAP02338
UniProt: B0VL70
Position
2811869..2812378
Genome map
AA seq 169 aa AA seqDB search
MAWQNVEVVHVVAMDKNHCIGKGNALPWHISADLKHFKEITQGGVVIMGRKTLESMGRAL
PNRVNWVITRDINWHFDGVKIAYSIEDALNAALEDAKNTEKQALFIIGGGEIFKQTLSIA
DRLELTHVDLDVQGDAHYPTIPSEFHKTASEQQVDEKSGTSFEFATYKK
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atggcatggcaaaatgtagaagttgtccacgttgtcgcaatggacaaaaatcactgtatt
ggtaaaggcaatgcgttgccatggcatatctctgccgatttaaaacattttaaagaaatc
acacaaggtggtgtggtgatcatgggccgcaaaacgcttgagtctatgggccgtgctcta
ccgaaccgtgtgaactgggtgattacccgtgacattaactggcattttgacggcgtaaaa
attgcgtattcaattgaagatgctttaaatgctgctttagaagatgccaaaaacaccgaa
aagcaagctttattcattattggtggtggtgaaatctttaagcaaaccttgtcaattgca
gaccgtcttgagctcactcatgttgacttagatgtacaaggtgatgcacattatccaaca
ataccgagtgaatttcacaaaactgcaagcgaacagcaagtagatgaaaaatcaggaact
tcattcgaatttgccacttataaaaaataa

DBGET integrated database retrieval system