KEGG   Acinetobacter baumannii SDF: ABSDF3263Help
Entry
ABSDF3263         CDS       T00660                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen-III synthase (UROS) (Uroporphyrinogen-III cosynthetase) (Hydroxymethylbilane hydrolyase [cyclizing])
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
abm  Acinetobacter baumannii SDF
Pathway
abm00860  Porphyrin and chlorophyll metabolism
abm01100  Metabolic pathways
abm01110  Biosynthesis of secondary metabolites
abm01120  Microbial metabolism in diverse environments
Module
abm_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:abm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ABSDF3263 (hemD)
Enzymes [BR:abm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     ABSDF3263 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: CAP02533
UniProt: B0VMB9
Position
3017591..3018358
Genome map
AA seq 255 aa AA seqDB search
MLFINTRPDSRAAELTHALQNKGFQVESLPLLELVAQPFSESLFQLYQQLTGAQAIVVVS
PTAVDVGMQYLAQSGLKIDELKYIQWIAVGQATANRLHDYGIEAHVPEVETSEGMLNLPL
LHRMQKSGSVAFWRGEGGRQFMMETLQQQGIQILNFVLYRRLCPQASYSTFKHLTQNSNY
NLDKWLVLITSEASWKYWLELCLKNKAQPDCVYLVLGPRLFQLVKDYRDQQQAHFHIIQL
ENLSPSGMIHHIQAL
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgttgtttattaatacccgacctgactcgcgtgcggctgaattaactcatgctttgcag
aataaggggtttcaggtcgagtctttacctcttttagaactggttgctcaacctttctca
gaatcactctttcaactctatcagcagttaactggtgcacaagcgattgtagtggttagt
cccactgctgttgatgtgggtatgcagtatttagcacaaagtggtttaaaaatagatgag
ctaaaatatattcaatggattgcggtggggcaggcgacggctaatcgtcttcacgactat
gggattgaagcgcatgttcctgaggttgaaacttccgagggaatgcttaatttgcctctt
cttcatcgtatgcaaaaatcaggtagtgtagctttttggagaggtgaaggcggccgtcaa
tttatgatggaaactttgcaacagcaaggaattcagattttaaattttgttctatatcgc
aggctgtgtccgcaagcttcatattcgacattcaaacatctgacacagaattcaaattat
aatttagataaatggctcgtcttaattaccagtgaggcgagctggaaatactggttagag
ctttgtttaaaaaataaggcacaacctgattgcgtatatttagttttaggaccacgcctt
tttcaacttgttaaagactatcgcgatcagcaacaagctcattttcacattattcaactt
gaaaatttatcgccttcggggatgattcatcacattcaggcattataa

DBGET integrated database retrieval system