KEGG   Acinetobacter baumannii SDF: ABSDF3293Help
Entry
ABSDF3293         CDS       T00660                                 

Gene name
dsbC
Definition
thiol:disulfide interchange protein (EC:5.3.4.1)
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
abm  Acinetobacter baumannii SDF
Brite
Enzymes [BR:abm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     ABSDF3293 (dsbC)
Secretion system [BR:abm02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   ABSDF3293 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3042766..3043581
Genome map
AA seq 271 aa AA seqDB search
MSFTRSQIFLACALASSLLFSACSKENKPQKEDALTATAPATGEASTIIERNAKQRLIET
LQKQFKNANINVKILDIKPTEVPNLYWVNLEGMTSVYTTSDGKYLIQGDVIRLGGKELHN
IGDSLQASENKKHLAALKNEDLIAYPAKGGKAKHVIYVFTDVSCPYCHKLHEHLAEINEK
SIEVRYIAWPRGEQFMPTMEAVWCSADRKAAFNQAVQGINIPPAQCKNPVREQYQLGLNM
GVNGTPAIYNVDGEYLGGYLTPDELIKRLDK
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgtcctttacccgatctcaaatttttcttgcctgtgctttggcttctagcctgttgttc
agtgcttgttctaaagaaaacaaaccacaaaaagaagatgcgctcacagcgaccgcacct
gctacaggggaagcttcaaccattattgaacgcaatgctaaacagcgtttaattgaaact
ttgcaaaaacaatttaagaatgcaaatatcaacgtcaagattttagatattaagcctacc
gaagttcctaatttatattgggttaatcttgaaggaatgacgtcggtttatacaacaagt
gatggtaaatacctgattcaaggcgatgtcatccgtttaggtggtaaagaacttcataat
atcggcgatagccttcaagcctcagaaaacaaaaagcatcttgctgctttaaaaaatgaa
gacttaattgcttatccagctaaaggcggtaaagctaaacatgtgatttatgtgtttacc
gatgtaagctgtccttactgccataaattacatgagcatttagctgagattaatgagaaa
agtattgaggttcgttacattgcatggccacgcggcgaacagtttatgccaactatggaa
gcggtttggtgtagtgcagaccgtaaagctgcatttaaccaagctgtacagggcattaat
attccaccagctcaatgtaaaaaccctgtccgtgaacaatatcaacttggtttaaacatg
ggtgtaaatggaacaccagctatttataatgttgatggcgagtacttaggtggataccta
acaccagatgaattaattaaacgtctggataaataa

DBGET integrated database retrieval system