KEGG   Acinetobacter baumannii SDF: ABSDF3295Help
Entry
ABSDF3295         CDS       T00660                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
abm  Acinetobacter baumannii SDF
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:abm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ABSDF3295 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ABSDF3295 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    ABSDF3295 (thrC)
Enzymes [BR:abm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     ABSDF3295 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3045183..3046322
Genome map
AA seq 379 aa AA seqDB search
MSNANRYTGLVDRYRDRLPVSATTRAISLGEGNTPLIKLENIPRIIGKDVEIYVKYEGLN
PTGSFKDRGMTMAVTKAVEEGSKAIICASTGNTSAAAAAYAARAGIKAFVLIPEGKIAMG
KMAQAMMYGAITMQIRGNFDDGMRLVKEVADQAPVTIVNSINPYRLQGQKTIAYEIVEAL
GRAPDYHCLPVGNAGNITAHWMGYTEAVANQPADQFEQVVYDAATDQFTGPKPEGLPTMV
GYQASGAAPFLRGAPVEKPETVATAIRIGNPQSWNHAKAVVRDSKGWFDELQDSEILEAQ
RLLSMYEGVFVEPASAASIGGAIRDIKAGKIAEGSVIVCTVTGNGLKDPDTAIKQCADAV
MLSIDATMDQVKDSILSNM
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgtctaatgccaatcgttatactggtcttgtagatcgttatcgtgaccgtttgccagtt
tcggcaactactcgtgctatctctttgggtgaaggcaacacccctctcattaaacttgag
aatattccacgtattattggcaaagacgttgaaatttatgtgaaatacgagggcttaaac
ccgactggttcatttaaagaccgtggtatgaccatggctgtaaccaaagcagttgaagaa
ggctctaaagcaattatctgtgcatctacaggtaacacttctgctgctgctgctgcctat
gctgcacgcgcaggtatcaaagcgtttgttttgattccggaaggcaaaattgcgatgggt
aaaatggcgcaagccatgatgtatggtgcgatcactatgcaaattcgtggtaacttcgat
gatggtatgcgtcttgtaaaagaagtggctgatcaagcacctgtaacgattgtaaactca
atcaacccttaccgtttgcaaggtcaaaaaactattgcttatgaaatcgttgaagcttta
ggccgtgcacctgattaccactgcttaccagttggtaacgcaggtaacattacagctcac
tggatgggttataccgaagcagtagctaaccagcctgctgaccaatttgaacaagttgtt
tatgacgctgcgactgatcaattcactggtccaaaaccggaaggcttaccaacaatggta
ggttatcaagcttctggcgcagctcctttcttacgtggtgctccagtagaaaaaccggaa
acagttgcaactgcgattcgtattggtaacccacaaagctggaaccatgcaaaagctgta
gtacgtgactctaaaggttggttcgatgaacttcaagacagcgaaattttagaagctcaa
cgcttactttctatgtatgaaggtgtatttgttgagccagcatctgctgcttctattggc
ggtgcaatccgtgatattaaagcgggtaaaattgctgaaggttctgtcattgtatgtact
gtaacgggtaatggcttgaaagaccctgatacagcaatcaaacaatgtgctgatgcagtg
atgttgtcaattgatgcaacaatggaccaagtaaaagattcgattttatctaatatgtaa

DBGET integrated database retrieval system