KEGG   Acinetobacter baumannii SDF: ABSDF3309Help
Entry
ABSDF3309         CDS       T00660                                 

Gene name
holC
Definition
DNA polymerase III subunit chi (EC:2.7.7.7)
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
abm  Acinetobacter baumannii SDF
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:abm00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    ABSDF3309 (holC)
   00240 Pyrimidine metabolism
    ABSDF3309 (holC)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    ABSDF3309 (holC)
   03430 Mismatch repair
    ABSDF3309 (holC)
   03440 Homologous recombination
    ABSDF3309 (holC)
Enzymes [BR:abm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     ABSDF3309 (holC)
DNA replication proteins [BR:abm03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     ABSDF3309 (holC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3058986..3059393
Genome map
AA seq 135 aa AA seqDB search
MAKVSFYLFETSEERQVDSACRLCRKILLKHSQIWWYCPDVQLQQTLDEKLWSFDPTSFI
AHGVDQVDAAVCISAKQPSEQGWLVFNFNNHTLEQVNHFSHIIEIVENNEAAKQIGREKF
KMYRRLGIEPRTFKL
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagttagcttttatctgtttgaaaccagtgaagaacggcaagtcgatagtgct
tgccgtttatgtcgaaaaattttactgaagcattcacaaatctggtggtattgcccagat
gtgcagttacaacaaacacttgatgaaaaattgtggagctttgatccgaccagctttatt
gcccatggcgttgatcaggtagatgcagcagtatgtatttcggctaaacaaccttctgaa
caaggttggctggtatttaattttaacaatcatacacttgaacaagtgaatcattttagc
cacattatagaaattgttgaaaataatgaagcagccaagcaaattggccgagaaaaattt
aaaatgtatcgtcgtttaggtatagaacctcgaacctttaaattataa

DBGET integrated database retrieval system