KEGG   Acinetobacter baumannii SDF: ABSDF3462Help
Entry
ABSDF3462         CDS       T00660                                 

Gene name
aceF
Definition
(GenBank) dihydrolipoamide S-acetyltransferase, E2 component of the pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
abm  Acinetobacter baumannii SDF
Pathway
abm00010  Glycolysis / Gluconeogenesis
abm00020  Citrate cycle (TCA cycle)
abm00620  Pyruvate metabolism
abm01100  Metabolic pathways
abm01110  Biosynthesis of secondary metabolites
abm01120  Microbial metabolism in diverse environments
abm01130  Biosynthesis of antibiotics
abm01200  Carbon metabolism
Module
abm_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:abm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABSDF3462 (aceF)
   00020 Citrate cycle (TCA cycle)
    ABSDF3462 (aceF)
   00620 Pyruvate metabolism
    ABSDF3462 (aceF)
Enzymes [BR:abm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     ABSDF3462 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_D23 RnfC_N GCV_H TFX_C CAT
Motif
Other DBs
NCBI-ProteinID: CAP02725
UniProt: B0VNY9
Position
complement(3196856..3198496)
Genome map
AA seq 546 aa AA seqDB search
MQIKTPDIGVDKANVAEILVKVGDRVEVDDSIVVLESDKATVEVPSTSAGVVKSILINQG
DDVTEGVALIEIEAEGAAQAAPEPTPAPAAEKPGAPAPAQQTQASAQPAAATSAATVEVT
VPDIGVEKALVGEILVKVGDQIDVEQSIVVVESDKATVEVPSTVAGVVKAIHLQAGQQVS
QGVLLATIEAEGQAPAAAPAAKAEAAPAPQAAAPKAAAPVATQSAPAASTSGTDKLTKEQ
EAENAKVYAGPAVRKLARELGVILSQVKTSGEHGRVVKEDIFAYVKSRLTAPQAAPVAQA
TAAPAGLPSLPDFTAFGGGEVKPMTRLQQVSVPQLSLNNYIPQVTQFDLADITELEAWRG
ELKDGFKKQGVSLTILAFIAKAVAHLLKEEPYFAGHLADDQKSVLLRNEIHMGIAVATPD
GLTVPVLRNPDQKSIKQIAVELGELSKKARDKKLTPKDLQGANFTITSLGSIGGTAFTPL
VNWPQVAILGISPATMQPVWNGKDFDPRLMLPLSLSYDHRVINGADAARFTNKLTKLLKD
IRTLLI
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgcaaattaagacccctgatattggtgtagataaagcaaacgtcgctgaaattttagta
aaagttggcgaccgtgttgaagttgatgacagtatcgttgtgcttgagtctgataaagca
actgttgaagtgcctagcacttcagcaggtgtcgtaaaaagtatcttgattaatcaaggt
gatgatgtgactgaaggtgttgctttgattgagatcgaagcagaaggtgcggcacaagca
gcaccggaaccaacaccagctcctgcggctgaaaagccaggtgctccagcacctgcgcaa
caaactcaagcttcagctcaacctgctgccgctacatcagctgcaactgttgaagtgact
gtacctgacatcggtgttgaaaaagcattggttggtgaaatcctcgttaaagtgggtgac
cagatcgatgttgaacaaagtattgtggttgtagagtcggataaagcgactgtggaagtc
ccaagtaccgttgctggtgttgtaaaagcaattcacttgcaagcaggccaacaagtttca
caaggtgtattgcttgcaacaattgaagctgaaggccaagcacctgctgctgcaccagcg
gcaaaagcagaagcagccccagctccacaggcagcagcacctaaagcagccgctcctgtt
gcaactcagtctgcacctgcggcgtctacatctggtactgataagttaacgaaagagcaa
gaagcagaaaacgctaaagtgtatgctggtcctgctgttcgtaagctggctcgtgaactt
ggtgtgatcttgtcacaagttaaaacttctggtgagcatggccgtgttgttaaagaagat
atctttgcttatgtgaagagtcgtttaactgcaccgcaagctgcaccagtagctcaagct
actgctgctccggctggattgccgtcattacctgactttactgcttttggtggcggtgaa
gtaaaaccaatgacgcgtttacagcaagtttctgtaccacagttgtctttaaacaactac
attccacaagtaactcagtttgaccttgcggatattactgagctagaagcttggcgtggt
gagttgaaagacggctttaagaaacaaggtgtgagcctaacaattttggcatttattgca
aaagcagtagcacacttgttgaaagaagagccttatttcgcgggtcacttagcagatgat
cagaaatctgtattgctccgtaatgaaatccatatgggtattgcggttgcgactccagat
ggtttgacagtgcctgtactacgtaatcctgaccaaaaatcaattaagcaaattgctgtt
gaattaggtgagttgagtaaaaaagcgcgtgataagaaattaacaccgaaagatttacaa
ggtgctaacttcacgatcacaagcttgggctcaattggcggtacagcatttacgccacta
gttaactggccacaagttgcaattttgggtatttcacctgcaacgatgcagcctgtatgg
aatggtaaagactttgatccacgcttaatgttgccgttatcattgtcttatgaccaccgt
gtaattaatggtgcggatgcagcgcgctttacaaataaacttacgaaacttcttaaagat
attcgtactttattaatctaa

DBGET integrated database retrieval system