KEGG   Acinetobacter baumannii SDF: ABSDF3605Help
Entry
ABSDF3605         CDS       T00660                                 

Gene name
pncA
Definition
bifunctional pyrazinamidase/nicotinamidase (EC:3.5.1.19 3.5.1.-)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
abm  Acinetobacter baumannii SDF
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:abm00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3350695..3351339)
Genome map
AA seq 214 aa AA seqDB search
MKMNKQPQNSALVVVDVQNGFTPGGNLAVADADTIIPTINQLAGCFENVVLTQDWHPDNH
ISFAANHPGKQPFETIELDYGSQVLWPKHCIQGTHDAEFHPDLNIPTAQLIIRKGFHAHI
DSYSAFMEADHTTMTGLTGYLKERGIDTVYVVGIATDFCVAWTALDAVKQGFKTLVIEDA
CKGIDLNGSLEQAWQTMQQQGVIRIQSTDLLNEC
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgaataaacaaccacaaaattcggctttagtcgtagttgacgtgcaaaatggt
tttacccctggtggaaacctagcagttgccgacgctgatacgattattccaaccattaac
caattggcaggttgttttgaaaatgtagtcctcactcaagactggcatccggataatcac
atttcttttgcagccaatcatccgggcaagcagccatttgaaacgattgaactggattat
ggatcacaggtgctttggcctaagcattgtatacaaggcactcatgatgccgaatttcat
ccggatttaaatatcccgacagctcaactgattatccgaaaaggttttcatgctcatatt
gatagttactcagcttttatggaagctgaccacaccacaatgacaggtttaacgggatat
ttaaaagaacgtggtattgatacggtctatgtggtcggaattgccacagacttttgtgtc
gcatggactgctttagatgcggttaagcaaggctttaaaactttagtaattgaagatgcg
tgcaaaggtattgatcttaatggttcattagaacaagcgtggcaaactatgcagcaacaa
ggggttatccgtattcaatcgactgatctgttgaatgaatgctag

DBGET integrated database retrieval system