KEGG   Acinetobacter baumannii AB0057: AB57_0029Help
Entry
AB57_0029         CDS       T00793                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
abn  Acinetobacter baumannii AB0057
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
29442..30005
Genome map
AA seq 187 aa AA seqDB search
MPGLYSANLDQQIIYLGEDGQHMFVGSMIRLKDQKNLTKDLVLGQNSIDWKQLPLKDAIK
TVKGNGQHVLAVFSDPNCPYCKQLEPELDKLKDVTIYTFIYPLKPQSIVVSRQVWCAPNQ
SYSWKKLIEQGVKPTVASCTNPIDRNLELGKKLGFNGTPTLIFANGFKLVGARSAEEIQA
VWKELGL
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgcctgggctatatagtgctaatctggaccagcaaattatttatcttggtgaagatggg
cagcacatgtttgtaggctctatgattcggttaaaagaccaaaagaacttaactaaagat
ctggttttaggacagaactcaattgattggaaacagttgcctttaaaagatgccattaaa
acagtcaaaggtaatggtcagcatgttttagcagtattttctgatccaaattgcccttat
tgtaagcagcttgaacctgaactcgacaagcttaaagatgtcactatttacacttttatc
tatcctttaaaacctcagtctattgtggtttctagacaagtttggtgtgcaccgaatcaa
tcatattcatggaaaaaattaattgagcaaggtgttaaaccaacggttgcgagctgtaca
aacccgattgaccgtaacttggaattagggaaaaaattaggttttaatggcacacctact
ctcatttttgctaacggatttaaactcgtcggagcgcgatctgccgaagaaattcaggca
gtttggaaagagttaggtttataa

DBGET integrated database retrieval system