KEGG   Acinetobacter baumannii AB0057: AB57_0111Help
Entry
AB57_0111         CDS       T00793                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
abn  Acinetobacter baumannii AB0057
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:abn00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AB57_0111 (galU)
   00052 Galactose metabolism
    AB57_0111 (galU)
   00500 Starch and sucrose metabolism
    AB57_0111 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    AB57_0111 (galU)
Enzymes [BR:abn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     AB57_0111 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
115635..116510
Genome map
AA seq 291 aa AA seqDB search
MIKKAVLPVAGLGTRFLPASKSIPKEMVTVVDRPAIEYVVREAVEAGIEQIILVTHSSKA
SIENYFDRNFELETALEQKKKFDLLDEITQIIPPHVKVVSVRQPQPLGLGHAVLCAKSVV
GEDDFAVLLPDVLVKDGSGQNDLSRMISRYNSSQAAQIMVEAVPDHLVDQYGIVDVAQSP
NEGESIAMQGIVEKPPVGAAPSNLSVVGRYVLPAKIMQLLENTPKGAGNEIQLTDAIAML
QDTDTVEAYRMQGQTFDCGSKLGYLKAVLHYGLEHPKLGMEFKQLIQELKL
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
gtgattaaaaaggcagttttacctgtagctggattaggtacacgttttttaccggcaagt
aagtcaattcctaaagaaatggtaacagtagttgaccgtcctgcgattgaatatgtagtg
cgtgaagctgtagaagcaggaattgagcaaattattctggtaacgcactcatctaaagca
tctattgaaaattattttgatcgaaactttgaacttgaaacggccttagagcaaaagaaa
aagtttgatctgcttgatgagattactcaaattatcccacctcatgtaaaggtagtaagt
gtaagacagccccaacctttaggtttaggacatgctgttttatgtgcaaagagtgttgtc
ggcgaagatgattttgcagtgctattaccagatgtactagtaaaagatggctctggacaa
aatgatttatctcgtatgatttctcgctataactcaagccaagctgctcaaatcatggtt
gaggcagtgcctgatcacttggtagatcaatatggtattgttgatgttgcacaaagtcca
aatgaaggcgaaagcattgctatgcagggtattgttgaaaaaccccctgtaggtgctgca
ccatcaaacttatctgtggttggccgctatgtgttacctgccaagattatgcaattactt
gagaacacgccgaaaggtgcaggtaatgaaattcagttaactgatgcaattgcaatgctt
caagacacagatactgttgaagcttatcgtatgcaaggccaaacgtttgactgtggtagt
aagcttggttatttaaaagctgtattacattatggtttagaacatccaaaattaggaatg
gaatttaaacagctgattcaagaacttaaattataa

DBGET integrated database retrieval system