KEGG   Acinetobacter baumannii AB0057: AB57_0148Help
Entry
AB57_0148         CDS       T00793                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
abn  Acinetobacter baumannii AB0057
Pathway
abn00071  Fatty acid degradation
abn00280  Valine, leucine and isoleucine degradation
abn00281  Geraniol degradation
abn00310  Lysine degradation
abn00360  Phenylalanine metabolism
abn00362  Benzoate degradation
abn00380  Tryptophan metabolism
abn00410  beta-Alanine metabolism
abn00627  Aminobenzoate degradation
abn00640  Propanoate metabolism
abn00650  Butanoate metabolism
abn00903  Limonene and pinene degradation
abn00930  Caprolactam degradation
abn01100  Metabolic pathways
abn01110  Biosynthesis of secondary metabolites
abn01120  Microbial metabolism in diverse environments
abn01130  Biosynthesis of antibiotics
abn01212  Fatty acid metabolism
Module
abn_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:abn00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    AB57_0148
   00650 Butanoate metabolism
    AB57_0148
  Lipid metabolism
   00071 Fatty acid degradation
    AB57_0148
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AB57_0148
   00310 Lysine degradation
    AB57_0148
   00360 Phenylalanine metabolism
    AB57_0148
   00380 Tryptophan metabolism
    AB57_0148
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AB57_0148
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AB57_0148
   00281 Geraniol degradation
    AB57_0148
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AB57_0148
   00627 Aminobenzoate degradation
    AB57_0148
   00930 Caprolactam degradation
    AB57_0148
Enzymes [BR:abn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     AB57_0148
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ACJ39579
Position
160739..161512
Genome map
AA seq 257 aa AA seqDB search
MQWQSILLEKRNGVGLITLNRPQALNALNSELISEINQALDQLEKDREVGCIVLAGSEKA
FAAGADIKEMADLAFPDIYLDDFFHLADRIAQRRKPLIAAVSGYALGGGCELALMCDFIY
CADNAKFGLPEVTLGVIPGIGGTQRLTHAIGKAKAMEMCLTARQMGAVEAEQSGLVARVF
SKEELLEQTLQAAEKIAARSLTANMMLKETINRAFEVNLTEGLRFERRMFHSIFATADQK
EGMQAFVEKRQANFKNQ
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgcagtggcaaagtattttattagaaaagcgtaatggggttggattgattacattaaat
cgccctcaagcgctcaatgccttaaatagtgaattaattagtgaaattaatcaggcatta
gatcaactcgaaaaagaccgtgaagttggctgcatcgtattagccggctcagaaaaagct
tttgccgcaggggccgacattaaagaaatggccgatttggcatttcccgatatttattta
gatgacttttttcatcttgcagaccgtattgcacagcgccgtaaacctttaattgctgcg
gtgagtggctatgcattgggtggtggctgtgaattagcactcatgtgtgactttatttac
tgtgctgacaatgccaagtttggtttacccgaagtcactttaggggtaattccgggtatt
ggtgggacacaacgattaacccatgccattggtaaagctaaagcaatggaaatgtgcctt
accgctcgccaaatgggcgcagtagaggcagaacaaagtggtttggttgcacgtgtgttt
agtaaagaagaattacttgaacaaaccttgcaagccgctgaaaaaatcgcagcacggtct
ttaactgcaaacatgatgctcaaagaaaccattaatcgagcttttgaggtgaatctcacc
gaaggtttacgttttgaacgccgcatgttccactccatttttgcaactgcggaccaaaaa
gaaggcatgcaggcatttgttgaaaaacggcaggcaaattttaaaaatcagtaa

DBGET integrated database retrieval system