KEGG   Acinetobacter baumannii AB0057: AB57_0148Help
Entry
AB57_0148         CDS       T00793                                 

Definition
(RefSeq) short-chain enoyl-CoA hydratase (EC:4.2.1.17)
  KO
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
abn  Acinetobacter baumannii AB0057
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:abn00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    AB57_0148
  Carbohydrate metabolism
   00640 Propanoate metabolism
    AB57_0148
   00650 Butanoate metabolism
    AB57_0148
  Lipid metabolism
   00071 Fatty acid degradation
    AB57_0148
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AB57_0148
   00310 Lysine degradation
    AB57_0148
   00360 Phenylalanine metabolism
    AB57_0148
   00380 Tryptophan metabolism
    AB57_0148
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AB57_0148
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AB57_0148
   00281 Geraniol degradation
    AB57_0148
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AB57_0148
   00627 Aminobenzoate degradation
    AB57_0148
   00930 Caprolactam degradation
    AB57_0148
Enzymes [BR:abn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     AB57_0148
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
160740..161513
Genome map
AA seq 257 aa AA seqDB search
MQWQSILLEKRNGVGLITLNRPQALNALNSELISEINQALDQLEKDREVGCIVLAGSEKA
FAAGADIKEMADLAFPDIYLDDFFHLADRIAQRRKPLIAAVSGYALGGGCELALMCDFIY
CADNAKFGLPEVTLGVIPGIGGTQRLTHAIGKAKAMEMCLTARQMGAVEAEQSGLVARVF
SKEELLEQTLQAAEKIAARSLTANMMLKETINRAFEVNLTEGLRFERRMFHSIFATADQK
EGMQAFVEKRQANFKNQ
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgcagtggcaaagtattttattagaaaagcgtaatggggttggattgattacattaaat
cgccctcaagcgctcaatgccttaaatagtgaattaattagtgaaattaatcaggcatta
gatcaactcgaaaaagaccgtgaagttggctgcatcgtattagccggctcagaaaaagct
tttgccgcaggggccgacattaaagaaatggccgatttggcatttcccgatatttattta
gatgacttttttcatcttgcagaccgtattgcacagcgccgtaaacctttaattgctgcg
gtgagtggctatgcattgggtggtggctgtgaattagcactcatgtgtgactttatttac
tgtgctgacaatgccaagtttggtttacccgaagtcactttaggggtaattccgggtatt
ggtgggacacaacgattaacccatgccattggtaaagctaaagcaatggaaatgtgcctt
accgctcgccaaatgggcgcagtagaggcagaacaaagtggtttggttgcacgtgtgttt
agtaaagaagaattacttgaacaaaccttgcaagccgctgaaaaaatcgcagcacggtct
ttaactgcaaacatgatgctcaaagaaaccattaatcgagcttttgaggtgaatctcacc
gaaggtttacgttttgaacgccgcatgttccactccatttttgcaactgcggaccaaaaa
gaaggcatgcaggcatttgttgaaaaacggcaggcaaattttaaaaatcagtaa

DBGET integrated database retrieval system