KEGG   Acinetobacter baumannii AB0057: AB57_0265Help
Entry
AB57_0265         CDS       T00793                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
abn  Acinetobacter baumannii AB0057
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:abn00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
283659..284585
Genome map
AA seq 308 aa AA seqDB search
MEVANVPRRHCCLFARPIPIVEVAAEADAMVTVFGILNLTEDSFFDESRRLDPAGAVTAA
IEMLRVGSDVVDVGPAASHPDARPVSPADEIRRIAPLLDALSDQMHRVSIDSFQPETQRY
ALKRGVGYLNDIQGFPDPALYPDIAEADCRLVVMHSAQRDGIATRTGHLRPEDALDEIVR
FFEARVSALRRSGVAADRLILDPGMGFFLSPAPETSLHVLSNLQKLKSALGLPLLVSVSR
KSFLGATVGLPVKDLGPASLAAELHAIGNGADYVRTHAPGDLRSAITFSETLAKFRSRDA
RDRGLDHA
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtggaagtcgccaatgtgccacggcgtcattgctgcctttttgctcgcccgatccccatc
gtggaagtcgctgcggaggccgacgccatggtgacggtgttcggcattctgaatctcacc
gaggactccttcttcgatgagagccggcggctagaccccgccggcgctgtcaccgcggcg
atcgaaatgctgcgagtcggatcagacgtcgtggatgtcggaccggccgccagccatccg
gacgcgaggcctgtatcgccggccgatgagatcagacgtattgcgccgctcttagacgcc
ctgtccgatcagatgcaccgtgtttcaatcgacagcttccaaccggaaacccagcgctat
gcgctcaagcgcggcgtgggctacctgaacgatatccaaggatttcctgaccctgcgctc
tatcccgatattgctgaggcggactgcaggctggtggttatgcactcagcgcagcgggat
ggcatcgccacccgcaccggtcaccttcgacccgaagacgcgctcgacgagattgtgcgg
ttcttcgaggcgcgggtttccgccttgcgacggagcggggtcgctgccgaccggctcatc
ctcgatccggggatgggatttttcttgagccccgcaccggaaacatcgctgcacgtgctg
tcgaaccttcaaaagctgaagtcggcgttggggcttccgctattggtctcggtgtcgcgg
aaatccttcttgggcgccaccgttggccttcctgtaaaggatctgggtccagcgagcctt
gcggcggaacttcacgcgatcggcaatggcgctgactacgtccgcacccacgcgcctgga
gatctgcgaagcgcaatcaccttctcggaaaccctcgcgaaatttcgcagtcgcgacgcc
agagaccgagggttagatcatgcctag

DBGET integrated database retrieval system