KEGG   Acinetobacter baumannii AB0057: AB57_0317Help
Entry
AB57_0317         CDS       T00793                                 

Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
abn  Acinetobacter baumannii AB0057
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:abn00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    AB57_0317
   00240 Pyrimidine metabolism
    AB57_0317
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    AB57_0317
   03430 Mismatch repair
    AB57_0317
   03440 Homologous recombination
    AB57_0317
Enzymes [BR:abn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     AB57_0317
DNA replication proteins [BR:abn03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     AB57_0317
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(334559..334966)
Genome map
AA seq 135 aa AA seqDB search
MAKVSFYLFETSEERQVDSACRLCRKILLKHSQIWWYCPDVQLQQTLDEKLWSFDPISFI
AHGVDQVDAAVCISAKQPSEQGWLVFNFNNHALEQVNHFSHIIEIVENNEAAKQIGREKF
KMYRRLGIEPRTFKL
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagttagcttttatctgtttgaaaccagtgaagaacggcaagtcgatagtgct
tgccgtttatgtcgaaaaattttactgaagcattcacaaatctggtggtattgcccagat
gtgcagttacaacaaacacttgatgaaaaattgtggagctttgatccgatcagctttatt
gcccatggcgttgatcaggtagatgcagcagtatgtatttcggctaaacaaccttctgaa
caaggttggctggtatttaattttaacaatcatgcacttgaacaagtgaatcattttagc
cacattatagaaattgttgaaaataatgaagcagccaagcaaattggccgagaaaaattt
aaaatgtatcgtcgtctaggtatagaacctcgaacctttaaattataa

DBGET integrated database retrieval system