KEGG   Acinetobacter baumannii AB0057: AB57_0327Help
Entry
AB57_0327         CDS       T00793                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
abn  Acinetobacter baumannii AB0057
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:abn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AB57_0327 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AB57_0327 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    AB57_0327 (thrC)
Enzymes [BR:abn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     AB57_0327 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(346625..347764)
Genome map
AA seq 379 aa AA seqDB search
MSNANRYTGLVDRYRDRLPVSATTRAISLGEGNTPLIKLENIPRIIGKDVEIYVKYEGLN
PTGSFKDRGMTMAVTKAVEEGSKAIICASTGNTSAAAAAYAARAGIKAFVLIPEGKIAMG
KMAQAMMYGAITMQIRGNFDDGMRLVKEVADQAPVTIVNSINPYRLQGQKTIAYEIVEAL
GRAPDYHCLPVGNAGNITAHWMGYTEAVANQPADQFEQVVYDAATDQFTGPKPEGLPTMV
GYQASGAAPFLRGAPVEKPETVATAIRIGNPQSWNHAKAVVRDSKGWFDELQDSEILEAQ
RLLSMYEGVFVEPASAASIGGAIRDIKAGKIAEGSVIVCTVTGNGLKDPDTAIKQCADAV
MLSIDATMDQVKDSILSNM
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgtctaatgccaatcgttatactggtcttgtagatcgttatcgtgaccgtttgccagtt
tcggcaactactcgtgctatctctttgggtgaaggcaacacccctctcattaaacttgag
aatattccacgtattattggcaaagacgttgaaatttatgtgaaatacgagggcttaaac
ccgactggttcatttaaagaccgtggtatgaccatggctgtaaccaaagcagttgaagaa
ggctctaaagcaattatctgtgcatctacaggtaacacttctgctgctgctgctgcctat
gccgcacgcgcaggtatcaaagcgtttgttttgattccggaaggcaaaattgcgatgggt
aaaatggcgcaagccatgatgtatggtgcgatcactatgcaaatccgtggtaacttcgat
gatggtatgcgtcttgtaaaagaagtggctgatcaagcacctgtaacgattgtaaactca
atcaacccttaccgtttgcaaggtcaaaaaactattgcttatgaaatcgttgaagcttta
ggccgtgcacctgattaccactgcttaccagttggtaacgcaggtaacattacagctcac
tggatgggttataccgaagcagtagctaaccagcctgctgaccaatttgaacaagttgtt
tatgacgctgcgactgatcaattcactggtccaaaaccagaaggcttaccaacaatggta
ggttatcaagcttctggcgcagctcctttcttacgtggtgctccagtagaaaaaccggaa
acagttgcaactgcgattcgtattggtaacccacaaagctggaaccatgcaaaagccgta
gtacgtgactctaaaggttggttcgatgaacttcaagacagcgaaattttagaagctcaa
cgcttactttctatgtatgaaggtgtatttgttgagccagcatctgctgcttctattggc
ggtgcaatccgtgatattaaagcgggtaaaattgctgaaggttctgtcattgtatgtact
gtaacgggtaatggcttgaaagaccctgatacagcaatcaaacaatgtgctgatgcagtg
atgttatcaattgatgcaacaatggaccaagtaaaagattcgattttatctaatatgtaa

DBGET integrated database retrieval system