KEGG   Acinetobacter baumannii AB0057: AB57_0327Help
Entry
AB57_0327         CDS       T00793                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
abn  Acinetobacter baumannii AB0057
Pathway
abn00260  Glycine, serine and threonine metabolism
abn00750  Vitamin B6 metabolism
abn01100  Metabolic pathways
abn01110  Biosynthesis of secondary metabolites
abn01120  Microbial metabolism in diverse environments
abn01230  Biosynthesis of amino acids
Module
abn_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:abn00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AB57_0327
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    AB57_0327
Enzymes [BR:abn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     AB57_0327
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP PK_C
Motif
Other DBs
NCBI-ProteinID: ACJ39753
Position
complement(346514..347653)
Genome map
AA seq 379 aa AA seqDB search
MSNANRYTGLVDRYRDRLPVSATTRAISLGEGNTPLIKLENIPRIIGKDVEIYVKYEGLN
PTGSFKDRGMTMAVTKAVEEGSKAIICASTGNTSAAAAAYAARAGIKAFVLIPEGKIAMG
KMAQAMMYGAITMQIRGNFDDGMRLVKEVADQAPVTIVNSINPYRLQGQKTIAYEIVEAL
GRAPDYHCLPVGNAGNITAHWMGYTEAVANQPADQFEQVVYDAATDQFTGPKPEGLPTMV
GYQASGAAPFLRGAPVEKPETVATAIRIGNPQSWNHAKAVVRDSKGWFDELQDSEILEAQ
RLLSMYEGVFVEPASAASIGGAIRDIKAGKIAEGSVIVCTVTGNGLKDPDTAIKQCADAV
MLSIDATMDQVKDSILSNM
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgtctaatgccaatcgttatactggtcttgtagatcgttatcgtgaccgtttgccagtt
tcggcaactactcgtgctatctctttgggtgaaggcaacacccctctcattaaacttgag
aatattccacgtattattggcaaagacgttgaaatttatgtgaaatacgagggcttaaac
ccgactggttcatttaaagaccgtggtatgaccatggctgtaaccaaagcagttgaagaa
ggctctaaagcaattatctgtgcatctacaggtaacacttctgctgctgctgctgcctat
gccgcacgcgcaggtatcaaagcgtttgttttgattccggaaggcaaaattgcgatgggt
aaaatggcgcaagccatgatgtatggtgcgatcactatgcaaatccgtggtaacttcgat
gatggtatgcgtcttgtaaaagaagtggctgatcaagcacctgtaacgattgtaaactca
atcaacccttaccgtttgcaaggtcaaaaaactattgcttatgaaatcgttgaagcttta
ggccgtgcacctgattaccactgcttaccagttggtaacgcaggtaacattacagctcac
tggatgggttataccgaagcagtagctaaccagcctgctgaccaatttgaacaagttgtt
tatgacgctgcgactgatcaattcactggtccaaaaccagaaggcttaccaacaatggta
ggttatcaagcttctggcgcagctcctttcttacgtggtgctccagtagaaaaaccggaa
acagttgcaactgcgattcgtattggtaacccacaaagctggaaccatgcaaaagccgta
gtacgtgactctaaaggttggttcgatgaacttcaagacagcgaaattttagaagctcaa
cgcttactttctatgtatgaaggtgtatttgttgagccagcatctgctgcttctattggc
ggtgcaatccgtgatattaaagcgggtaaaattgctgaaggttctgtcattgtatgtact
gtaacgggtaatggcttgaaagaccctgatacagcaatcaaacaatgtgctgatgcagtg
atgttatcaattgatgcaacaatggaccaagtaaaagattcgattttatctaatatgtaa

DBGET integrated database retrieval system