KEGG   Acinetobacter baumannii AB0057: AB57_1041Help
Entry
AB57_1041         CDS       T00793                                 

Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
abn  Acinetobacter baumannii AB0057
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:abn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AB57_1041
   00052 Galactose metabolism
    AB57_1041
Enzymes [BR:abn01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     AB57_1041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1106376..1107521)
Genome map
AA seq 381 aa AA seqDB search
MKKLAILGVTVYSFAQLANAATLNVKPYGTTQDGQKVDLYTMSNNNGVSVSFISFGGVIT
QILTPDAQGKQNNIVLGFDDLKGYEVTDTKEGIHFGGLIGRYANRIGNAKFSLDGKTYNL
EKNNGPNSLHSGNPGFDKRVWQVKPLVSQGETVKASLKLTSPNGDQGFPGKLDVEVIYSL
SDQNEFKIEYKAKTDQPTVVNLTNHSYFNLSGAGNNPYGVLDHVVQLNADRVLVTDQNSL
PTGEIASVAGTPFDFRTPKAIVKDIRANNQQLAYGYGYDQTWVINQKSQGKLNLAAVVVD
PKSKRTMQVLTTEPSVQMYTANHLLGNIVGANGVLYRQADALALETQHFPDSPNQPAFPS
TRLNPNQTYNSVTVFKFGVQK
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattagcaattttaggtgttacggtttatagctttgcacaactagcaaatgca
gcaacgttaaatgtaaaaccatatggtacgactcaagacggccaaaaagttgatctatac
accatgagtaataacaatggagtctcggtatcttttattagttttggtggtgtaattaca
caaatcttgactcccgatgcacaaggcaaacaaaataatattgttttgggctttgatgac
ttaaaaggctatgaagtcactgataccaaggaaggtattcattttggcggattaattggt
cgttatgcgaaccggattggcaatgctaaatttagcttagatggaaaaacgtataacctc
gaaaaaaataatggcccgaactcattacatagcggcaatcctggttttgataaacgtgtt
tggcaagttaagcccctcgtttctcaaggtgaaaccgttaaagcttctctgaagttaacc
agtccaaatggtgatcaaggttttcccggaaagttagatgtggaagtaatctacagtctt
tcagatcaaaatgaatttaagattgaatataaagccaaaactgatcagcctacagtcgtc
aacctcaccaaccacagttatttcaacttgtcaggagctggtaataatccttatggtgtg
ctggatcatgtggtacaactcaatgcagaccgtgtattggtgaccgatcaaaactcttta
ccaacaggtgaaattgcttcagttgcaggtacaccttttgattttcggacgcctaaggcg
attgtgaaagatattcgagcgaataatcagcaattggcctatggatatggctatgaccaa
acttgggtaattaatcaaaagtctcaagggaaactcaatcttgcggctgttgtagttgat
ccaaaatctaaacgaacaatgcaagtcttaaccactgaaccaagtgtccaaatgtataca
gccaatcatttattaggaaatattgttggcgcaaatggcgtactctatcgacaagcagac
gcactagcattagaaacacagcattttccagacagcccgaatcaaccggctttcccgtct
acacgtttaaacccaaatcaaacttataacagtgttactgtatttaagtttggtgttcaa
aaatag

DBGET integrated database retrieval system