KEGG   Acinetobacter baumannii AB0057: AB57_1064Help
Entry
AB57_1064         CDS       T00793                                 

Definition
acyl-CoA thioesterase (EC:3.1.1.5 3.1.2.-)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
abn  Acinetobacter baumannii AB0057
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:abn01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1132711..1133334)
Genome map
AA seq 207 aa AA seqDB search
MYKSYLSGSKSLLLIALSMLPMLVSAKTILILGDSISAGYGIDPKQGWVQLLQKRLDQQY
PKQHKVVNASMSGETTSGALARLPKLLQTYKPEVVVIELGGNDGLRGQPPQMIQQNLSQL
VHLSQQQKAQVILFGMKIPPNYGTAYSKAFETNYKTVSQKYQVKLLPFFLDGVAGQKQLM
QNDLIHPNAQAQSKLLNLAYPYIKGAL
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgtataaatcttatttgtctggttctaaaagtctcttgctcatcgcattgagcatgttg
cctatgttggtctcggccaaaactattttaattttaggagatagtattagtgccggttac
ggaatagaccctaaacaaggttgggtacaattactacaaaaacgtctagaccaacagtat
cccaaacaacataaagtggtcaatgcaagtatgagtggtgaaaccacaagtggcgctttg
gccagattacctaagcttttacaaacgtataaacccgaagtcgtagttattgaattaggt
gggaatgatggtttacgaggtcaacccccacaaatgattcaacaaaatttgtcgcagctc
gtccatttaagccaacaacaaaaggcgcaggttattctttttggtatgaagattccgcct
aattatggcacagcttatagcaaagcatttgaaaccaattataaaactgtaagccaaaaa
tatcaggtgaaactgctaccgtttttccttgatggcgtcgctggacaaaaacaactaatg
caaaatgacttgattcatccaaatgcccaagcgcagtcaaaattacttaatttagcttat
ccatacataaaaggtgccctatag

DBGET integrated database retrieval system