KEGG   Acinetobacter baumannii AB0057: AB57_1203Help
Entry
AB57_1203         CDS       T00793                                 

Definition
GMC oxidoreductase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
abn  Acinetobacter baumannii AB0057
Brite
KEGG Orthology (KO) [BR:abn00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    AB57_1203
Enzymes [BR:abn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     AB57_1203
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1291283..1292953)
Genome map
AA seq 556 aa AA seqDB search
MTINNYDYDYLIIGSGFGGSVSACRLTEKGYSVAVMEMGRRWKAEDFAKNNWNTRRWIWR
PGMKLFGYFNMRFFRHVTIICGNAVGGGSITYANTLLVPPEHIWDEGTWADAADWKNEMP
QHYAEAERMLGVTDNKIFGPADHMLKKMGEAVGVGHTFKPTRVATFFPPEGEEGGKTYPD
PYFNGEGPDRGTCTACGGCMTGCKHNAKNTLDKNYLYFAEKNGAKVYEETKVVDVKPLNG
KADGSDGYEVTTECSSSWFNKQRRTWRVRNVIFSASSLGTQEMLFRLKQSGSLPNISDDL
GNRVRTNAESILGVRFFGKDVDMSKGVAIGSSIYIDHDTHIEATRYQSGSDAMGLMCTYM
AKGKPGWTRIFFWLWALICHPFIFLRMSNPVSFARQTLIFLVMQTADASINMRLKRNWFW
PFGKVLSSEGKKLPVYIPQANAFTEKVAKMFNGHPMTTITEILFNVPFTAHCMGGCAIAS
SPERGVVDGQNRVFNYKNLYVVDGSMLGANLGVNPSLTITALAERAMSYIPAKHTLEEQA
YTQTQGEVLEAAKVSA
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgacaataaacaattatgactatgattacctgattattggttcaggctttggtggtagt
gtttctgcttgccgtttaaccgaaaaaggctactcggttgccgtaatggaaatggggcga
cgctggaaagctgaagattttgctaaaaacaactggaatacccgccgttggatttggcgt
ccgggcatgaaacttttcggttatttcaacatgcgtttttttcgccatgtcaccattatt
tgcggtaatgccgtaggtggcggttcaattacctatgccaataccctactggttccacct
gaacatatttgggatgaaggcacgtgggcagatgccgcggactggaaaaatgaaatgcct
cagcactatgctgaagcagaacgtatgcttggcgtgactgataataaaattttcggccct
gccgaccacatgctaaagaaaatgggtgaagcagtcggtgttggccatacatttaaacct
actcgtgttgccactttctttccaccggaaggtgaagaaggtgggaagacctaccctgac
ccttattttaacggcgaaggtccagaccgtggcacttgtaccgcatgtggcggttgtatg
acgggttgtaaacacaacgcaaaaaatacattagataaaaactatttgtactttgccgaa
aaaaatggcgctaaggtttatgaagaaaccaaagtagttgacgttaaacctctcaatggt
aaagccgatggcagcgatggttatgaagtcacgactgaatgttcaagctcatggtttaac
aagcaacgtcgtacttggcgagttcgtaatgtgattttctctgcatcttctttaggcaca
caagagatgttgttccgtttaaaacagtccggttctctgccaaatatttctgatgatttg
ggtaatcgggttcgtaccaatgccgagtcgattttaggtgttcgtttttttggtaaagat
gtcgacatgagtaaaggtgttgctattggttcaagtatttacattgaccatgacactcac
attgaagcgactcgctaccaaagtggttcagatgccatgggccttatgtgtacttacatg
gctaaaggcaaaccgggttggacacgtattttcttttggttatgggcactcatttgccat
ccatttattttccttcgcatgagtaatcctgtcagttttgcacgtcaaaccttaattttc
ttggtgatgcaaaccgctgatgcctcaatcaacatgcgtttaaaacgcaattggttctgg
ccttttggcaaggtgttatcgagcgaaggtaaaaagctacctgtttatattccgcaggcc
aatgcatttaccgaaaaagttgccaaaatgtttaatggccaccccatgacgaccattacc
gaaattttgtttaacgtaccttttacagctcactgtatgggtggttgtgcaattgcttca
agtccagagcgtggtgtggtagatggacaaaatcgggtgtttaactataaaaacttatac
gttgtagatggttcaatgttaggtgcaaatttgggcgttaacccaagtctcaccattaca
gctctagcagaacgtgcaatgtcttatattccggctaaacatactttagaagaacaagct
tatactcaaactcagggtgaagttttagaagcagcaaaagtatctgcttaa

DBGET integrated database retrieval system