KEGG   Acinetobacter baumannii AB0057: AB57_1810Help
Entry
AB57_1810         CDS       T00793                                 

Gene name
gspK
Definition
general secretion pathway protein K
Orthology
K02460  
general secretion pathway protein K
Organism
abn  Acinetobacter baumannii AB0057
Pathway
Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:abn00001]
 Environmental Information Processing
  Membrane transport
   03070 Bacterial secretion system
    AB57_1810 (gspK)
Secretion system [BR:abn02044]
 Type II secretion system
  General secretion pathway protein [MD:M00331]
   AB57_1810 (gspK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1894308..1895267
Genome map
AA seq 319 aa AA seqDB search
MAVSYKHQQGVALLTILIMVALATILAASIAKHQNNTMENTAYLMRQNQSLLYAKSAEAF
FSELLIQDANNAGGVDHLKETWAQPMPPFSIEEGSVSGRLLDESGKFNLNNLTNGEGIVN
EDAKSWFERLLVRVGLPAELSQAVIDWQDPNDEPTGPMGAESSYYEGLDPGYMAANTKFH
RIEELKLVRGFDGKKFDLIAPYISALPENSKLNINTASPLVLASMDEKLDIGAIERELQT
RQQNLKFFQNVDELWQLNAFSAVDSQKKNQVNSLIDVKSSFFQAQIEVVLNNRKRQFTSA
LMRKDKQVYVYSRSMAPFN
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggccgttagttacaaacaccaacagggtgtcgctttactgacaatacttattatggtt
gccttggctacaattttagcggcttctattgccaagcatcaaaataatactatggaaaat
acagcttacttaatgcgccaaaatcaatctttgctttatgcaaaaagtgcagaagccttt
ttttcagaattattaattcaagatgcaaataatgcaggtggagtagatcatttaaaagag
acatgggcacaacctatgccgccgttttctattgaagagggttcagtatctggtcgtttg
cttgatgagtctggtaaatttaatttaaataatctaactaacggggaaggcattgtaaat
gaagatgctaaaagttggtttgaacgcttattggtacgtgtgggattaccagccgaatta
agccaagctgtgattgattggcaagatccaaatgatgagccaactgggccaatgggggca
gaaagtagttattatgaaggtttggatccaggttacatggctgcgaatactaaattccat
cgtattgaagagttaaagctagtgagaggctttgatggaaaaaaatttgatctaattgct
ccatatatttctgctttaccagaaaattcgaagttaaatattaatactgcttcgccattg
gttttagcaagtatggatgaaaaattagatataggagctatcgaaagagaattacagaca
cgccaacaaaatttaaagttcttccaaaatgtagatgaattatggcaattgaatgctttt
tcagcggttgatagtcaaaagaaaaatcaagtaaatagccttattgatgttaaatccagc
ttctttcaagctcagattgaagttgttctaaataataggaagcgacagtttactagtgct
ttaatgagaaaagataagcaagtatatgtttattcaagaagcatggctccatttaactaa

DBGET integrated database retrieval system