KEGG   Acinetobacter baumannii AB0057: AB57_1825Help
Entry
AB57_1825         CDS       T00793                                 

Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
abn  Acinetobacter baumannii AB0057
Pathway
abn00620  Pyruvate metabolism
abn00630  Glyoxylate and dicarboxylate metabolism
abn01100  Metabolic pathways
abn01110  Biosynthesis of secondary metabolites
abn01120  Microbial metabolism in diverse environments
abn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:abn00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AB57_1825
   00630 Glyoxylate and dicarboxylate metabolism
    AB57_1825
Enzymes [BR:abn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     AB57_1825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: ACJ41204
Position
1908191..1910356
Genome map
AA seq 721 aa AA seqDB search
MTARIQKGKLAIAKELYDFIENEALPGSGLDSETYWKNFEQVVVDLSPKNKALLAKRDEL
QAKIDEWHRNNKFELGAYKAFLTEIGYLLPEVEDFQITTENVDEEIALLAGPQLVVPVRN
ARYCLNAANARWGSLYDALYGFDVISEEGGAEKGKGYNPVRGAKVIEFAKNFLNEIFPLA
QGSHADATKYAIEQNKLVVTLKDGTKTGLAHEAQFVGFNGEEANPSEVVLLSNGLHVIIE
IDANSPIGQTDLAGVKDLTLEAAVTTIQDLEDSVAAVDAEEKVEGYRNWLGLMKGTLQES
IEKNGKTIVRALNKDREIKNLIGGTTKLHGRSLMLLRNVGHLMTNPAILVDGEEIFEGIM
DALVTPLLSIADIRSENENKNSRKGSMYIVKPKMHGPEEVAFAVELFERAEQALGLPAKS
LKIGIMDEERRTSVNLKNCIAAAKDRTIFINTGFMDRTGDEIHTSMEAAPVVRKEAVKTQ
KWIAAYENRNVAIGLKCGLQGKAQIGKGMWPKPDSMKDMLATKAAHPNAGASCAWVPSPT
GAVLHAMHYHQVNVKARQDQLKAEEMLSLDDLLTPPFATDTNWSAEEINNELENNCQGIL
GYVVRWVDLGVGCSKVPDINNVGLMEDRATLRISSQHVANWLRHGIVTREQVEEVLKRMA
KIVDEQNANDPLYKPMAANFETNIAFQAASDLIFKGCEQPSGYTEPLLHAARLKLKGYTG
D
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgactgcacgtattcaaaaaggcaagttagcgattgctaaagaactttacgattttatc
gaaaatgaagctttaccaggttctggtttagatagtgaaacttactggaagaactttgag
caagttgttgtcgaccttagtccaaagaataaagcattattggctaagcgtgatgaatta
caagcaaaaattgatgaatggcaccgcaacaataaatttgaattaggtgcttacaaagca
tttttaactgaaattggttatttattaccagaagttgaagacttccaaattactactgaa
aacgtagatgaagaaattgcattgttagcaggcccacaattagtagtacctgtacgtaat
gcacgttattgcttaaatgcagcaaatgcacgctggggttctttgtacgatgcactttac
ggcttcgatgtaatttcagaagaaggcggtgcagaaaaaggaaaaggatataaccctgta
cgtggtgcgaaagttattgagtttgctaaaaacttcttaaatgaaattttcccgcttgcg
caaggctcacatgctgatgcaactaaatatgcaatcgagcagaataaactcgttgtgact
ttaaaagatggtactaaaactggcttagctcatgaagctcagtttgtgggtttcaatggt
gaagaagcgaacccttcagaagttgttcttttgagtaatggcttacatgtcattattgaa
attgatgcgaatagcccaattggccaaactgatttagcgggtgttaaagatctaacactt
gaagctgcggttacaacaattcaggatcttgaagactctgtagcagctgttgatgcagaa
gaaaaggttgaaggttatcgtaactggttaggtttgatgaagggcactcttcaagaatct
atcgaaaaaaatggtaaaacaattgttcgcgctttgaataaagaccgtgaaattaaaaat
ttgatcggtggcacaacaaaacttcatggtcgttcacttatgttacttcgtaacgtaggt
catttaatgacgaatccagcgatattagttgatggtgaagaaattttcgaaggtattatg
gatgcgttggtaacgccattgttatcaattgctgacatccgtagtgaaaacgaaaataaa
aactctcgtaaagggtctatgtatattgttaaaccaaaaatgcatggccctgaagaagtt
gcttttgctgttgagttatttgagcgtgctgagcaagccttaggattaccagcgaagtct
ttaaaaatcggtattatggatgaagaacgccgtacatctgtaaacttgaaaaactgtatt
gctgctgctaaagatcgcacaatctttattaacactgggttcatggaccgtactggtgat
gaaatccatacttctatggaagctgctccagttgttcgtaaagaagcggttaaaacacaa
aaatggattgctgcttacgaaaaccgtaacgttgcaatcggtttgaaatgtggtttacaa
ggtaaagcacagattggtaaaggcatgtggccaaaaccagatagcatgaaagatatgttg
gcaactaaagctgctcatccaaatgctggtgcttcatgtgcttgggttccatcaccaact
ggtgctgtacttcatgcgatgcattaccatcaagtaaatgtaaaagcacgtcaagatcag
ttaaaagctgaagaaatgttgtcattagatgacttgttaactcctccatttgcaactgat
acaaactggtcagcagaagaaattaataacgagctcgaaaataactgccaaggtatttta
ggttacgttgtgcgttgggttgacttaggtgtaggttgttcaaaagttcctgatattaac
aacgtgggcttaatggaagaccgtgcaacattacgtatttcttctcaacatgttgccaac
tggttacgtcacggtatcgtgactcgtgaacaagttgaagaagtgcttaaacgcatggca
aaaattgttgatgaacaaaatgcgaatgatccattgtataaaccaatggcagctaacttt
gaaactaatattgctttccaagcagcttcagaccttatctttaaaggttgtgaacagcct
tctggttatactgagccattactacatgcggctcgtttaaaattaaaaggttatacaggt
gactaa

DBGET integrated database retrieval system