KEGG   Acinetobacter baumannii AB0057: AB57_1840Help
Entry
AB57_1840         CDS       T00793                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
abn  Acinetobacter baumannii AB0057
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:abn00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    AB57_1840
Enzymes [BR:abn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     AB57_1840
Transfer RNA biogenesis [BR:abn03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    AB57_1840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1928009..1928866
Genome map
AA seq 285 aa AA seqDB search
MFITTTCPNDALIEQLLPILEEASQILLQEYQNYSAGYEFTIEEKHDDSPVTQADLKVNR
FLLKHLAEITPELPVLSEESDYSARHAWSSCWMLDPLDGTKEFIHERDEFTINLSLIEGR
ETIFSVIVVPCEQVVYLGYLKDLPFKYSFSQQQWYQYQKTPYSKQAPVQIGLSHSSKNPK
YQKFIEPIEKIRTVIRREAGSAYKFCMMLEGEIDIYPRFHPTSEWDTSSGQGLLESIGGG
LLTLTGKPFEYNQRDTVLNGGFIAFRDQESKKIAFEALAQSGVLD
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgtttataacaacaacttgccccaatgatgctttaattgaacagctactaccaatcttg
gaagaagctagccaaatcttattacaagaatatcaaaattattcggctggatatgaattt
acgattgaagaaaaacatgatgattcacctgtaacgcaagcagatttaaaggtaaatcgt
tttttattaaagcatcttgcagaaattacacctgagttaccagttttatcggaagaaagt
gactatagtgctcgccatgcttggtcttcttgctggatgctagatccacttgatggtacg
aaagagtttatacatgagcgagatgagttcacgataaacttgagtttgattgaagggcgt
gaaacgattttttcggtgattgttgtgccatgtgaacaggtcgtttatttaggttattta
aaggatttaccctttaaatatagctttagccaacaacaatggtatcaatatcaaaaaaca
ccttattcaaaacaagctcctgtacaaattggtttaagtcatagtagtaaaaatccgaaa
tatcagaaattcattgaacctattgaaaagattcgtaccgtaattcgtcgtgaagcgggt
agcgcttataagttttgtatgatgttagaaggcgagatcgatatttatcctagatttcat
ccgacatcagaatgggataccagctcaggtcaaggattattagaaagtataggtggaggt
ttactcactctaacaggtaagccctttgaatataaccaacgtgataccgtattaaatggg
ggctttatcgcatttcgtgatcaggaaagcaaaaaaatagcatttgaagctttagctcaa
tcaggtgttttggattga

DBGET integrated database retrieval system