KEGG   Acinetobacter baumannii AB0057: AB57_1921Help
Entry
AB57_1921         CDS       T00793                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
abn  Acinetobacter baumannii AB0057
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:abn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AB57_1921 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AB57_1921 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AB57_1921 (trpB)
Enzymes [BR:abn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AB57_1921 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
2005846..2007051
Genome map
AA seq 401 aa AA seqDB search
MQHQINGIALPNEQGFFGEYGGQFIPPHLKEAMDEINVAYEEIRHTPEFQNELADLFANY
VGRPSPLFHAKRLSEQLGGAQIYLKREDLNHTGAHKINHCLGEALLAKYMGKKKVIAETG
AGQHGVALATACALVGIPCEIHMGQVDIEKEHPNVVKMKILGAHLVSVTRGTATLKDAVD
SAFEEYLKDPKNFIYAIGSVVGPHPFPKMVRDFQSIIGNEIKEQTHHRFGKNPDYVVACV
GGGSNAIGAFTAFLNDSDVKLVGVEPAGHGLETHMHSATLTLGKPSQIHGMACYVLENEA
GEPLPVHSIASGLDYPGVGPQHSFLKDLGRVEYSTATDQECLDAFMTLSRVEGIVPALES
SHAVAWAIREASKLPKETMIVVNLSGRGDKDSDYVAEKLKL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgcaacatcaaattaatggtattgctttaccgaatgaacaaggattttttggtgaatat
ggagggcaatttattcctccacatttaaaagaagcaatggatgaaattaatgttgcttat
gaagaaattcgccatacaccagaatttcaaaatgaattagcagacctctttgcaaattat
gtcggccgtccaagtcctttatttcatgcaaaacgcctttcagaacagttaggtggcgcg
caaatttatttaaagcgtgaagacttaaatcataccggtgcccacaaaattaatcactgt
ttaggtgaggctctacttgccaaatatatgggcaaaaagaaagtcattgccgagactggt
gcgggacagcatggcgttgctttagcaacggcttgtgctttagttggtattccatgtgaa
attcacatgggtcaagtagatattgaaaaagaacaccctaatgtggtcaaaatgaaaatt
ttgggtgctcatttagtttcagtaacacgtggtacagcaaccttaaaagatgcagtggat
agcgcttttgaagaatatttaaaagaccctaaaaactttatttatgcaattggttctgtg
gttggaccacatccatttccaaaaatggttcgagattttcaatcgattattggtaatgaa
attaaagagcagacgcatcatcgttttggtaaaaacccagattatgttgtcgcatgtgtt
ggtggcggttcaaatgcaatcggtgcctttacagcatttctaaatgattcggatgtgaaa
ttggttggggttgaaccagcaggacatggtttagaaactcacatgcattcggcaacttta
accttaggtaaaccaagtcaaattcatggtatggcgtgttacgtgcttgaaaatgaagct
ggtgaaccgttacccgtgcattctattgcttcaggattggactatcctggtgttgggcca
cagcatagtttcttaaaagatttaggccgtgtggaatatagcactgcaactgaccaagaa
tgtttggatgcttttatgaccttatctcgtgtagaaggaattgttcctgcgcttgaaagc
tcacatgctgtcgcatgggcaatacgtgaagcgtcaaagctgccgaaagaaaccatgatc
gtggtgaatctatcgggtcgtggcgataaagattctgattatgtggcagaaaaacttaag
ctttaa

DBGET integrated database retrieval system