KEGG   Acinetobacter baumannii AB0057: AB57_1921Help
Entry
AB57_1921         CDS       T00793                                 

Definition
(GenBank) tryptophan synthase subunit beta
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
abn  Acinetobacter baumannii AB0057
Pathway
abn00260  Glycine, serine and threonine metabolism
abn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
abn01100  Metabolic pathways
abn01110  Biosynthesis of secondary metabolites
abn01130  Biosynthesis of antibiotics
abn01230  Biosynthesis of amino acids
Module
abn_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:abn00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AB57_1921
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AB57_1921
Enzymes [BR:abn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AB57_1921
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACJ41296
Position
2005613..2006818
Genome map
AA seq 401 aa AA seqDB search
MQHQINGIALPNEQGFFGEYGGQFIPPHLKEAMDEINVAYEEIRHTPEFQNELADLFANY
VGRPSPLFHAKRLSEQLGGAQIYLKREDLNHTGAHKINHCLGEALLAKYMGKKKVIAETG
AGQHGVALATACALVGIPCEIHMGQVDIEKEHPNVVKMKILGAHLVSVTRGTATLKDAVD
SAFEEYLKDPKNFIYAIGSVVGPHPFPKMVRDFQSIIGNEIKEQTHHRFGKNPDYVVACV
GGGSNAIGAFTAFLNDSDVKLVGVEPAGHGLETHMHSATLTLGKPSQIHGMACYVLENEA
GEPLPVHSIASGLDYPGVGPQHSFLKDLGRVEYSTATDQECLDAFMTLSRVEGIVPALES
SHAVAWAIREASKLPKETMIVVNLSGRGDKDSDYVAEKLKL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgcaacatcaaattaatggtattgctttaccgaatgaacaaggattttttggtgaatat
ggagggcaatttattcctccacatttaaaagaagcaatggatgaaattaatgttgcttat
gaagaaattcgccatacaccagaatttcaaaatgaattagcagacctctttgcaaattat
gtcggccgtccaagtcctttatttcatgcaaaacgcctttcagaacagttaggtggcgcg
caaatttatttaaagcgtgaagacttaaatcataccggtgcccacaaaattaatcactgt
ttaggtgaggctctacttgccaaatatatgggcaaaaagaaagtcattgccgagactggt
gcgggacagcatggcgttgctttagcaacggcttgtgctttagttggtattccatgtgaa
attcacatgggtcaagtagatattgaaaaagaacaccctaatgtggtcaaaatgaaaatt
ttgggtgctcatttagtttcagtaacacgtggtacagcaaccttaaaagatgcagtggat
agcgcttttgaagaatatttaaaagaccctaaaaactttatttatgcaattggttctgtg
gttggaccacatccatttccaaaaatggttcgagattttcaatcgattattggtaatgaa
attaaagagcagacgcatcatcgttttggtaaaaacccagattatgttgtcgcatgtgtt
ggtggcggttcaaatgcaatcggtgcctttacagcatttctaaatgattcggatgtgaaa
ttggttggggttgaaccagcaggacatggtttagaaactcacatgcattcggcaacttta
accttaggtaaaccaagtcaaattcatggtatggcgtgttacgtgcttgaaaatgaagct
ggtgaaccgttacccgtgcattctattgcttcaggattggactatcctggtgttgggcca
cagcatagtttcttaaaagatttaggccgtgtggaatatagcactgcaactgaccaagaa
tgtttggatgcttttatgaccttatctcgtgtagaaggaattgttcctgcgcttgaaagc
tcacatgctgtcgcatgggcaatacgtgaagcgtcaaagctgccgaaagaaaccatgatc
gtggtgaatctatcgggtcgtggcgataaagattctgattatgtggcagaaaaacttaag
ctttaa

DBGET integrated database retrieval system