KEGG   Acinetobacter baumannii AB0057: AB57_1930Help
Entry
AB57_1930         CDS       T00793                                 

Definition
dihydrolipoamide acetyltransferase (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
abn  Acinetobacter baumannii AB0057
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:abn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AB57_1930
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AB57_1930
   00020 Citrate cycle (TCA cycle)
    AB57_1930
   00620 Pyruvate metabolism
    AB57_1930
Enzymes [BR:abn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AB57_1930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2016532..2018022
Genome map
AA seq 496 aa AA seqDB search
MEEGTIAQWLIKEGDSFNKGDEICEIETTKIVNVLEAPFAGTLRKILAKDGDTLPVGGLI
AVCADSEISNAEIEKFIASLGGSAAKAPEASSEQSKSETFAPVAEKAEQPQSVAASAPAP
TKVAKGDYAVPESLQGYQTSDELFATPHALKLAEKHNVNLAKVRGSGREGRISVQDIQKA
VQAAGGQWPDVKQQTQAKVIKSTADDSQVLATPVARRLAKQWGINLNDCRVSGTRGRVCK
EDVEAVYYRNNPTSVNEQSAQCAAQPQSTITTVAMNGMRKVIASRLQAAKRNAPHFRLVV
DLNVEALQKLRKQINETVPQVKLSINDMLIKAAAAALIKVPEVNVQFDEATQSILQFSQA
DISVAVAIPNGLITPIVKAANQKSLAQISDDMRDLATRAKTGKLQPDEFQGGSFSISNLG
MLGIKQFDAIINPPQGAIMALGASESRAVVENGNVVVREIVTATLSCDHRVIDGAVGAKF
LASFKQFVENPALILV
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaggcacgatcgcccaatggttgattaaagagggtgatagctttaataagggc
gatgaaatttgtgaaattgaaaccacaaaaatcgtcaatgtattagaagcaccttttgct
ggaacgctccgtaaaattttagcgaaagatggtgatactttacctgttgggggtcttata
gccgtatgtgctgatagtgaaatttctaatgcagaaattgaaaaatttattgcatcacta
ggtggttcagcagctaaggcccctgaagcatcttcggaacaaagtaaatcggaaacattt
gcacctgttgctgaaaaagccgaacaaccacagtccgtagctgcaagtgctccagctcct
acaaaggtagcgaaaggtgactacgctgtaccagagtcattacaaggctatcaaacatct
gatgagttgtttgcaacgccacatgcgttaaagcttgcagaaaagcacaatgtgaacttg
gcaaaagtcaggggttctggtcgtgaaggacgtattagtgttcaagacatccagaaagct
gtgcaggctgctggtggtcagtggcctgatgttaagcagcaaactcaagctaaagtgatt
aaatctacagccgatgatagccaagttttagcgacacctgtagcacgtcgtttagcaaaa
caatggggtattaacctaaatgactgccgtgtttcaggtactcgtggccgtgtctgcaaa
gaagatgttgaagcagtttactatcgtaacaatccaacgtcggtaaatgaacaatctgct
caatgtgcagctcaaccacaatcaacaattacgactgtggcgatgaatgggatgcgtaaa
gtgattgcttcacgcttacaagctgcaaaacgtaatgcaccgcatttccgcttagtggtc
gatctcaacgtagaggctttgcaaaaattacgtaagcagattaatgaaacggttcctcaa
gtcaaactttctattaatgacatgctaattaaagcagctgctgcggcactgattaaagtg
cctgaggtgaatgttcaatttgatgaggcgactcaatcaattttacagttctctcaagcg
gatatttcggtggccgtagcgattccaaacggtttaattacacccattgtaaaagcagcg
aatcagaagtctttagcacaaatttccgatgacatgcgtgatttggcaacgcgtgctaag
actggcaagttacaacctgacgagtttcagggaggcagctttagcatttcaaatttagga
atgttaggcattaaacagttcgatgccattattaacccaccgcaaggtgcaattatggca
ttaggtgcttcggaatctcgcgctgttgtcgaaaatggcaatgtagtggttcgtgagatt
gtcacagcgacgttgtcatgcgatcaccgagttattgatggcgcagttggggcgaaattc
ttggccagctttaagcagtttgttgaaaaccctgctttaattttggtgtag

DBGET integrated database retrieval system