KEGG   Acinetobacter baumannii AB0057: AB57_2316Help
Entry
AB57_2316         CDS       T00793                                 

Definition
(GenBank) 1-deoxy-D-xylulose-5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
abn  Acinetobacter baumannii AB0057
Pathway
abn00900  Terpenoid backbone biosynthesis
abn01100  Metabolic pathways
abn01110  Biosynthesis of secondary metabolites
abn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:abn00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AB57_2316
Enzymes [BR:abn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     AB57_2316
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C NAD_binding_3 Semialdhyde_dh Epimerase RMMBL
Motif
Other DBs
NCBI-ProteinID: ACJ42432
UniProt: B7I9U9
Structure
PDB: 

Jmol
Position
complement(2400781..2401977)
Genome map
AA seq 398 aa AA seqDB search
MTQSVCILGVTGSIGRSTLKILGQHPDKYSVFAVSAHSRISELVEICKQFRPKVVVVPEQ
KIAELKTLFAQQNISDIDVLAGQEGLVDIASHTDVDIVMAAIVGAAGLLPTLAAVKAGKR
VLLANKEALVMSGEIMMQAARDHQALLLPVDSEHNAIFQSLPHNYLQADRTGQPQLGVSK
ILLTASGGPFLNHSLEQLVHVTPQQACKHPNWSMGQKISVDSATLMNKGLELIEACHLFS
ISEHFVTVVVHPQSIIHSMVQYVDGSTLAQMGNPDMCTPIAHALAWPERLQTNVPALDLF
EYSQLNFQAPDTQKFPALNLARQAMRAGGLAPTILNAANEIAVEAFLMERIGFTSIPQVV
EHTLEKLENAAAESIECILDKDKVARSVAQQYISSIGG
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgacacaatctgtttgcatattgggtgtaaccggttctattggacgaagtaccttaaaa
attttaggtcaacatccagataagtattcagtctttgcagtttcggcgcatagtcgaatt
tctgaacttgttgaaatctgcaaacagtttcgacctaaagttgttgttgttcctgaacag
aaaatagctgaactaaaaacactatttgctcagcaaaatatatcggatattgatgtttta
gctgggcaagagggtttagtcgatatcgcatctcatacagatgtggatattgttatggct
gcaattgtaggggcagctgggctgttgccaactttagcggctgttaaggcaggtaaaaga
gtactacttgccaacaaagaagcattagttatgtctggtgaaatcatgatgcaagctgct
cgtgatcatcaggcattgttattgccagttgattcggaacataatgcaattttccaatca
ttgcctcataattatttacaagcagatagaacagggcaaccacagctaggtgtatctaaa
atattgcttacagcatctggtggtccttttttaaatcattccctagaacaattggttcat
gtaacaccgcaacaagcatgtaaacatccaaactggtcaatgggacaaaaaatttcggtt
gactcggctactcttatgaataaagggttagagttaattgaggcttgtcatttattttca
atatctgaacattttgttacagttgttgttcatccacaaagtatcattcactctatggtg
cagtatgttgatggctcaacattagcacaaatgggtaacccggatatgtgtactccgatt
gcacatgcattggcatggcctgagcgtttacaaactaatgttcctgctttagatttattt
gagtattctcaacttaattttcaggcaccggatacccaaaaatttcctgcattaaatttg
gctagacaagcaatgcgtgcgggaggtttggcaccaaccattttgaatgcagctaatgaa
attgcagttgaagcattcttaatggaaaggattggatttacaagtattccgcaagtggta
gagcatactttggaaaaattagagaatgcagcggctgaaagcatcgagtgcattttagat
aaagataaagtggcccgatctgtagctcagcaatatatatcaagtattggaggctga

DBGET integrated database retrieval system