KEGG   Acinetobacter baumannii AB0057: AB57_2475Help
Entry
AB57_2475         CDS       T00793                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
abn  Acinetobacter baumannii AB0057
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:abn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AB57_2475
Enzymes [BR:abn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     AB57_2475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2570425..2570862)
Genome map
AA seq 145 aa AA seqDB search
MNAPETIFALALASNLDADQHFTFAYTQLATLGKVQFSSVYQIPCRDGIGDDYWNSACLL
RSTLACEQIESFLKKLETDSGRVRPSHHISLDVDLIAWGSDLDHMQFNSKKLPLALDVKI
PLYELWHCESLKVDSPLYPVVNFKV
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
ttgaacgcaccagaaacaatttttgcgctcgccctagcgagtaatttagacgcagatcag
cactttacttttgcctatacgcaattagcaactttggggaaagtgcagttttcatctgtt
tatcaaattccatgccgagatggtattggagatgattactggaattcagcatgtctatta
agaagtactttagcctgtgaacaaattgaatcttttctcaaaaaacttgagacagattct
ggacgtgttcgtccgtcgcatcatatttctttagatgtagatttgattgcatggggaagt
gatctcgaccatatgcaatttaattctaaaaaactacctttagcactcgatgtcaaaatc
cctttatatgagctttggcattgtgaaagtttaaaggttgatagtccgctttatccggtc
gtcaattttaaagtttaa

DBGET integrated database retrieval system